EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05690 - ThiG)
FAM  PF05690
PID  ThiG
DES  Thiazole biosynthesis protein ThiG
IPR  IPR008867
ANO  28
ALN  263
AID  0.482682
APH  ((((((((((((((THIG_FUSNN/4-254:0.18288,THIG_CAMJE/9-257:0.16851):0.18319,THIG_CLOPE/3-254:0.21187):0.09539,THIG_CLOAB/3-255:0.17083):0.24919,(THIG_CHLTE/3-256:0.44976,(THIG_ECOLI/1-253:0.18363,THIG_VIBCH/1-253:0.16815):0.11774):0.10079):0.10632,THIG_DEIRA/6-259:0.31817):0.03639,(((THIG_ODOSI/7-261:0.29679,THIG_PORPU/17-277:0.25276):0.06785,THIG_CYACA/29-289:0.30866):0.09437,THIG_SYNY3/397-656:0.18192):0.13697):0.11197,(THIG_AQUAE/12-265:0.29903,(THIG_CAUCR/17-269:0.26544,(THIG_XANCP/9-264:0.18095,THIG_PSEAE/10-265:0.11492):0.12485):0.09117):0.14273):0.02540,(THIG_BACSU/3-256:0.23458,THIG_BACHD/5-258:0.30486):0.12893):0.15210,(THIG_STRCO/5-256:0.17654,(THIG_MYCTU/5-252:0.18062,THIG_CORGL/1-254:0.26137):0.03039):0.17454):0.37587,(THIG_RALSO/12-267:0.24022,THIG_NEIMA/1-256:0.20818):0.14551):0.08014,THIG_ERWAM/1-250:0.31223):0.06812,THIG_BRUME/1-255:0.16872):0.12157,Q8KJ35_RHILO/1-255:0.11912):0.09791,THIG_RHIET/1-255:0.12666,THIG_AGRT5/1-255:0.11515);
ATP  ((((((((((((((THIG_FUSNN/4-254,THIG_CAMJE/9-257),THIG_CLOPE/3-254),THIG_CLOAB/3-255),(THIG_CHLTE/3-256,(THIG_ECOLI/1-253,THIG_VIBCH/1-253))),THIG_DEIRA/6-259),(((THIG_ODOSI/7-261,THIG_PORPU/17-277),THIG_CYACA/29-289),THIG_SYNY3/397-656)),(THIG_AQUAE/12-265,(THIG_CAUCR/17-269,(THIG_XANCP/9-264,THIG_PSEAE/10-265)))),(THIG_BACSU/3-256,THIG_BACHD/5-258)),(THIG_STRCO/5-256,(THIG_MYCTU/5-252,THIG_CORGL/1-254))),(THIG_RALSO/12-267,THIG_NEIMA/1-256)),THIG_ERWAM/1-250),THIG_BRUME/1-255),Q8KJ35_RHILO/1-255),THIG_RHIET/1-255,THIG_AGRT5/1-255);
ATL  9.27159
DNO  23
DLN  789
DID  0.509533
DPH  ((((((((((((THIG_STRCO/5-256:0.21180,THIG_MYCTU/5-252:0.22411):0.04587,THIG_CORGL/1-254:0.32344):0.07094,((Q8KJ35_RHILO/1-255:0.18841,THIG_AGRT5/1-255:0.22852):0.13115,(THIG_RALSO/12-267:0.16402,THIG_NEIMA/1-256:0.26327):0.06431):0.18455):0.06428,(THIG_CAUCR/17-269:0.23325,(THIG_XANCP/9-264:0.15662,THIG_PSEAE/10-265:0.14470):0.06582):0.10534):0.12810,(THIG_CHLTE/3-256:0.38323,(THIG_ECOLI/1-253:0.18594,THIG_VIBCH/1-253:0.29218):0.10314):0.10393):0.15437,THIG_SYNY3/397-656:0.22972):0.15330,THIG_BACSU/3-256:0.30625):0.10200,THIG_AQUAE/12-265:0.38729):0.07775,((THIG_ODOSI/7-261:0.23347,THIG_PORPU/17-277:0.22483):0.08626,THIG_CYACA/29-289:0.22465):0.08051):0.26014,THIG_CAMJE/9-257:0.21506):0.07111,THIG_FUSNN/4-254:0.20349):0.08748,THIG_CLOPE/3-254:0.16429,THIG_CLOAB/3-255:0.23196);
DTP  ((((((((((((THIG_STRCO/5-256,THIG_MYCTU/5-252),THIG_CORGL/1-254),((Q8KJ35_RHILO/1-255,THIG_AGRT5/1-255),(THIG_RALSO/12-267,THIG_NEIMA/1-256))),(THIG_CAUCR/17-269,(THIG_XANCP/9-264,THIG_PSEAE/10-265))),(THIG_CHLTE/3-256,(THIG_ECOLI/1-253,THIG_VIBCH/1-253))),THIG_SYNY3/397-656),THIG_BACSU/3-256),THIG_AQUAE/12-265),((THIG_ODOSI/7-261,THIG_PORPU/17-277),THIG_CYACA/29-289)),THIG_CAMJE/9-257),THIG_FUSNN/4-254),THIG_CLOPE/3-254,THIG_CLOAB/3-255);
DTL  7.56085
RID  0.484538
RPH  (((((THIG_BACSU/3-256:0.30760,(((((THIG_FUSNN/4-254:0.18511,THIG_CAMJE/9-257:0.16843):0.18649,THIG_CLOPE/3-254:0.21040):0.09781,THIG_CLOAB/3-255:0.17222):0.25181,(THIG_CHLTE/3-256:0.45925,(THIG_ECOLI/1-253:0.18497,THIG_VIBCH/1-253:0.16795):0.11393):0.10781):0.10909,(((THIG_ODOSI/7-261:0.29900,THIG_PORPU/17-277:0.25406):0.06692,THIG_CYACA/29-289:0.30621):0.09402,THIG_SYNY3/397-656:0.18931):0.12064):0.11707):0.04400,(THIG_AQUAE/12-265:0.29420,(THIG_CAUCR/17-269:0.27101,(THIG_XANCP/9-264:0.18433,THIG_PSEAE/10-265:0.11416):0.11485):0.10219):0.12874):0.14582,(THIG_STRCO/5-256:0.17099,(THIG_MYCTU/5-252:0.17951,THIG_CORGL/1-254:0.26297):0.03840):0.18307):0.42164,(THIG_RALSO/12-267:0.21970,THIG_NEIMA/1-256:0.21682):0.08097):0.22138,Q8KJ35_RHILO/1-255:0.11491,THIG_AGRT5/1-255:0.19018);
RTP  (((((THIG_BACSU/3-256,(((((THIG_FUSNN/4-254,THIG_CAMJE/9-257),THIG_CLOPE/3-254),THIG_CLOAB/3-255),(THIG_CHLTE/3-256,(THIG_ECOLI/1-253,THIG_VIBCH/1-253))),(((THIG_ODOSI/7-261,THIG_PORPU/17-277),THIG_CYACA/29-289),THIG_SYNY3/397-656))),(THIG_AQUAE/12-265,(THIG_CAUCR/17-269,(THIG_XANCP/9-264,THIG_PSEAE/10-265)))),(THIG_STRCO/5-256,(THIG_MYCTU/5-252,THIG_CORGL/1-254))),(THIG_RALSO/12-267,THIG_NEIMA/1-256)),Q8KJ35_RHILO/1-255,THIG_AGRT5/1-255);
RTL  7.88705
LNK  Q8KJ35_RHILO/1-255:Q8KJ35:AL672115
LNK  THIG_AGRT5/1-255:Q8UCD2:AE009203
LNK  THIG_AQUAE/12-265:O67926:AE000776
LNK  THIG_BACHD/5-258:Q9KCY6:
LNK  THIG_BACSU/3-256:O31618:Z99110
LNK  THIG_BRUME/1-255:Q8YEZ2:
LNK  THIG_CAMJE/9-257:Q9PNP6:AL139077
LNK  THIG_CAUCR/17-269:Q9A746:AE005862
LNK  THIG_CHLTE/3-256:Q8KEJ1:AE012841
LNK  THIG_CLOAB/3-255:P58262:AE007789
LNK  THIG_CLOPE/3-254:Q8XK02:AP003191
LNK  THIG_CORGL/1-254:Q8NNY6:AP005280
LNK  THIG_CYACA/29-289:O19915:AF022186
LNK  THIG_DEIRA/6-259:Q9RYY1:
LNK  THIG_ECOLI/1-253:P30139:M88701
LNK  THIG_ERWAM/1-250:Q9F812:
LNK  THIG_FUSNN/4-254:Q8RI63:AE010479
LNK  THIG_MYCTU/5-252:P96263:BX842573
LNK  THIG_NEIMA/1-256:Q9JWI4:AL162752
LNK  THIG_ODOSI/7-261:P49570:Z67753
LNK  THIG_PORPU/17-277:P51361:U38804
LNK  THIG_PSEAE/10-265:Q9I6B4:AE004475
LNK  THIG_RALSO/12-267:Q8Y372:AL646057
LNK  THIG_RHIET/1-255:O34293:
LNK  THIG_STRCO/5-256:Q9S2N4:AL939111
LNK  THIG_SYNY3/397-656:Q55710:D64002
LNK  THIG_VIBCH/1-253:Q9KVS4:AE004097
LNK  THIG_XANCP/9-264:Q8P632:AE012430
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  THIG_STRCO/5-256
ASQ  PFVLGGTTYASRLIMGTGGAPSLDVLERALVASGTELTTVAMRRVNASV---HGSVLSVLERLGIRVLPNTAGCFTAGEAVLTARLAREAL------GTDLVKLEVIADERTLLPDPVELLDAAETLVDDGFTVLPYTNDDPVLARKLEDAGCAAIMPLGSPIGSGLGIRNPHNFQLIVEHA-RVPVILDAGAGTASDVALAMELGCAGVMLASAVTRAQEPVLMAAAMRAGVEAGRLARRAGRIPRRH.FAEASSPAEGLAV
DSQ  CCCTTCGTCCTCGGCGGTACGACGTACGCGTCCCGCCTGATCATGGGTACGGGCGGGGCGCCCAGCCTGGACGTGCTGGAGCGCGCGCTGGTGGCCTCCGGGACGGAGCTGACGACCGTCGCGATGCGGCGGGTGAACGCCTCGGTG---------CACGGCTCCGTGCTGTCCGTGCTGGAGCGGCTCGGCATCCGGGTGCTGCCGAACACGGCCGGCTGCTTCACCGCCGGGGAGGCGGTGCTCACGGCCCGCCTCGCGCGCGAGGCGCTC------------------GGCACGGACCTGGTCAAGCTGGAGGTCATCGCGGACGAGCGCACCCTGCTGCCGGACCCGGTCGAGCTGCTGGACGCGGCGGAGACGCTGGTGGACGACGGGTTCACCGTGCTGCCGTACACCAACGACGACCCGGTGCTCGCGCGGAAGCTGGAGGACGCCGGGTGCGCGGCGATCATGCCGCTGGGCTCGCCGATCGGGTCAGGCCTCGGGATCCGCAACCCGCACAACTTCCAGCTGATCGTGGAGCACGCG---CGCGTACCGGTGATCCTGGACGCCGGGGCCGGTACGGCGTCGGACGTGGCGCTGGCGATGGAGCTGGGGTGCGCGGGTGTGATGCTGGCCTCGGCGGTGACGCGGGCGCAGGAGCCGGTGCTGATGGCTGCGGCGATGCGGGCGGGGGTGGAGGCGGGGCGGTTGGCTCGGCGGGCCGGGCGGATTCCGCGGCGGCAT...TTCGCCGAGGCGTCGTCTCCTGCGGAGGGCCTGGCGGTG
TRN  11011111101111101
NAM  THIG_MYCTU/5-252
ASQ  KLVIGDRSFASRLIMGTGGATNLAVLEQALIASGTELTTVAIRRVDAD---GGTGLLDLLNRLGITPLPNTAGSRSAAEAVLTAQLAREAL------NTNWVKLEVIADERTLWPDAVELVRAAEQLVDDGFVVLPYTTDDPVLARRLEDTGCAAVMPLGSPIGTGLGIANPHNIEMIVAGA-RVPVVLDAGIGTASDAALAMELGCDAVLLASAVTRAADPPAMAAAMAAAVTAGYLARCAGRIPKRF.WAQASSPAR----
DSQ  AAGTTGGTTATCGGTGACCGCAGCTTCGCCTCGCGGCTCATCATGGGTACTGGGGGTGCGACCAATCTGGCGGTGCTAGAGCAGGCTCTGATCGCCTCAGGTACCGAGCTGACCACCGTCGCGATACGCCGGGTCGACGCCGAC---------GGGGGAACCGGCCTGCTCGACCTGCTCAACCGGCTCGGCATCACACCGCTACCCAACACCGCGGGGTCCCGCAGCGCCGCGGAAGCGGTCCTGACAGCGCAGTTGGCCCGTGAGGCGCTG------------------AACACCAACTGGGTCAAGCTCGAGGTGATTGCCGACGAACGCACCCTGTGGCCTGATGCGGTCGAATTAGTCCGGGCTGCAGAACAATTGGTGGACGACGGATTTGTGGTCCTACCGTACACAACCGACGACCCGGTGCTGGCCCGCCGGCTAGAAGATACCGGTTGCGCAGCGGTGATGCCGCTGGGTTCGCCGATCGGCACCGGCCTTGGTATCGCCAACCCGCACAATATCGAGATGATCGTCGCCGGTGCC---CGCGTTCCCGTGGTGCTGGACGCGGGCATCGGTACCGCCAGCGATGCCGCGTTGGCGATGGAGTTGGGTTGCGATGCCGTGTTGTTGGCCAGTGCGGTGACCCGGGCCGCCGACCCGCCGGCGATGGCCGCGGCGATGGCCGCCGCGGTGACCGCCGGATATCTGGCGCGTTGCGCGGGGCGGATCCCGAAACGCTTC...TGGGCTCAGGCTTCCAGCCCGGCACGA------------
TRN  10010101100011000
NAM  THIG_CORGL/1-254
ASQ  MLHIADKTFDSHLIMGTGGATSQALLEESLVASGTQLTTVAMRRHQATT-SSGESIFAMLRRLEIALLPNTAGCRTARDAVLTAQLAREAL------DTNWVKVEVIADEHTLLPDTVELLDACELLVHDGFTVLAYTSDDPITASRLEDCGVAAVMPLGSPIGTGLGILNPHNIELICSRA-SVPVILDAGVGTASDATLAMELGCDGVLLASAINRAQNPVAMAESMFHAVEAGRLAAQAGRIPQRQ.HAVASSSFEGLAS
DSQ  ATGCTGCATATTGCTGATAAAACTTTCGATTCCCACCTCATCATGGGCACCGGCGGAGCCACCTCTCAGGCGTTGCTGGAGGAATCCCTTGTCGCCAGTGGAACTCAATTGACCACCGTGGCGATGCGTCGACACCAAGCAACCACC---TCTAGCGGAGAATCCATCTTTGCCATGCTGCGCCGCCTCGAGATCGCCCTTCTCCCCAATACTGCAGGCTGCCGCACTGCCCGCGACGCCGTCCTCACTGCACAATTGGCTCGGGAAGCCCTC------------------GATACCAACTGGGTGAAAGTGGAGGTCATCGCCGATGAACACACATTGCTGCCCGACACCGTTGAGCTTCTTGATGCCTGCGAACTCCTCGTCCACGACGGCTTCACCGTTCTGGCTTACACCTCTGACGATCCCATCACTGCCAGCCGACTAGAAGACTGTGGCGTTGCAGCTGTCATGCCATTGGGCTCCCCGATCGGAACCGGCCTGGGCATTCTCAACCCGCACAACATTGAACTGATTTGCAGCCGCGCG---AGCGTACCCGTGATCCTCGACGCCGGTGTAGGCACTGCCTCTGATGCCACACTCGCAATGGAACTCGGCTGCGACGGCGTCCTTCTGGCCTCCGCTATCAACCGCGCCCAAAATCCCGTCGCGATGGCCGAATCCATGTTCCACGCCGTTGAAGCCGGAAGATTAGCCGCCCAAGCAGGCCGGATCCCGCAACGCCAA...CATGCGGTGGCCTCATCAAGTTTTGAAGGTTTGGCATCC
TRN  10010101100011000
NAM  THIG_PSEAE/10-265
ASQ  PFVIAGRTYGSRLLVGTGKYKDLDETRRAIEASGAEIVTVAVRRTNIGQNPDEPNLLDVIPPDRYTILPNTAGCYDAVEAVRTCRLARELLD-----GHNLVKLEVLADQKTLFPNVVETLKAAEQLVKDGFDVMVYTSDDPIIARQLAEIGCIAVMPLAGLIGSGLGICNPYNLRIILEEA-KVPVLVDAGVGTASDAAIAMELGCEAVLMNTAIAHAKDPVMMAEAMKHAIVAGRLAYLAGRMPRKL.YASASSPLDGLID
DSQ  CCCTTCGTCATCGCCGGCCGTACCTATGGCTCGCGCCTGCTGGTGGGGACCGGCAAGTACAAGGACCTCGACGAGACCCGCCGGGCCATCGAGGCCTCCGGAGCGGAGATCGTCACGGTGGCGGTGCGGCGCACCAACATCGGGCAGAATCCCGACGAGCCGAACCTGCTGGATGTGATCCCGCCGGATCGCTACACCATCCTGCCGAACACCGCCGGCTGCTATGACGCGGTCGAGGCCGTGCGCACCTGCCGCCTGGCCCGCGAGCTGCTGGAC---------------GGGCACAACCTGGTCAAGCTGGAAGTCCTCGCCGACCAGAAGACCCTGTTCCCCAACGTCGTCGAGACCCTCAAGGCCGCCGAGCAACTGGTGAAGGACGGCTTCGACGTGATGGTGTACACCAGCGACGACCCGATCATCGCCCGCCAACTGGCCGAGATCGGCTGCATCGCGGTGATGCCGCTGGCCGGCCTGATCGGCTCCGGCCTGGGCATCTGCAACCCCTACAACCTGCGCATCATCCTCGAGGAAGCC---AAGGTCCCGGTGCTGGTAGACGCCGGCGTGGGCACCGCTTCCGATGCAGCGATCGCCATGGAGCTGGGTTGCGAGGCGGTGCTGATGAACACCGCCATCGCCCATGCCAAGGACCCGGTGATGATGGCCGAGGCCATGAAGCACGCGATCGTCGCCGGTCGTCTCGCCTACCTGGCCGGACGCATGCCGCGCAAGCTG...TATGCCAGCGCCTCGTCGCCGCTGGACGGCCTGATCGAC
TRN  11011111101111111
NAM  THIG_XANCP/9-264
ASQ  ALVIAGKPYRSRLLTGTGKFKDLDETRLATEAAAAQIVTVAIRRVNIGQDPNAPSLLDVLPPDRYTLLPNTAGCYTAEDAVRTCRLARELLD-----GHNLTKLEVLGDERTLYPDVVQTLKAAEQLVADGFEVMVYTSDDPILAKRLEEIGCVAVMPLAAPIGSGLGIQNKYNLLEIIENA-KVPIIVDAGVGTASDAAIAMELGCDGVLMNTAIAGARDPILMASAMRKAIEAGREAFLAGRIPRKR.YASASSPVDGVIG
DSQ  GCGCTGGTGATCGCCGGCAAGCCCTACCGTTCGCGCCTGCTGACCGGCACCGGCAAGTTCAAGGACCTGGACGAAACCCGCCTGGCCACCGAGGCCGCTGCCGCGCAGATCGTCACCGTGGCCATTCGCCGGGTGAACATTGGCCAGGACCCCAACGCGCCCAGCCTGCTCGATGTGCTGCCGCCGGACCGCTACACCCTGCTCCCCAATACCGCCGGCTGCTACACCGCCGAAGACGCGGTGCGCACCTGCCGGCTGGCCCGTGAGCTGCTGGAT---------------GGCCACAACCTCACCAAGCTGGAAGTGCTGGGCGACGAGCGCACGCTCTATCCGGACGTGGTGCAGACGCTCAAGGCCGCCGAACAACTGGTCGCCGACGGTTTCGAGGTCATGGTGTACACCTCCGATGACCCGATCCTGGCCAAGCGGCTGGAAGAAATCGGCTGCGTGGCGGTGATGCCGCTGGCCGCGCCGATCGGCTCGGGCCTGGGCATCCAGAACAAGTACAACCTGCTGGAAATCATCGAAAACGCC---AAGGTGCCGATCATCGTCGACGCCGGCGTGGGCACCGCCTCCGATGCCGCCATTGCGATGGAACTGGGCTGCGACGGCGTGCTGATGAACACCGCCATTGCCGGTGCACGCGACCCGATCCTGATGGCCAGCGCGATGCGCAAGGCGATCGAAGCCGGCCGCGAGGCGTTCCTGGCTGGCCGGATTCCACGCAAGCGC...TACGCCTCGGCATCGAGCCCGGTCGATGGCGTGATCGGA
TRN  11011111101111111
NAM  THIG_CAUCR/17-269
ASQ  TWTVAGRTFRSRLIVGTGKYKDYATNAAAARAAGAEIVTVAVRRVNLTD-PSQPLLVDYVKPTEFTYLPNTAGCFTGEDAVRTLRLAREAG------GWDLVKLEVLSDPKTLFPDMEETLRSLKLLVADGFQVMVYCSDDPVYARKLEEAGAVAIMPLGAPIGSGLGIQNRVNLRIIIENA-KVPVLVDAGVGTASDAAIGMELGCDAILMNTAIAEAKDPIRMAKAMKHAVIAGREAYLAGRMQKRL.YADPSSPLAGLI-
DSQ  ACCTGGACCGTCGCCGGCCGCACCTTCCGCTCGCGCCTGATCGTCGGCACGGGCAAGTACAAGGACTATGCGACCAACGCCGCCGCCGCCCGCGCGGCCGGGGCCGAGATCGTCACCGTGGCCGTGCGCCGCGTGAACCTGACCGAC---CCCAGCCAGCCTTTGCTGGTCGACTATGTCAAACCGACCGAATTCACCTACCTGCCCAACACCGCCGGCTGTTTCACCGGCGAGGACGCGGTGCGCACCCTGCGTTTGGCCCGCGAGGCCGGC------------------GGCTGGGACTTGGTCAAGCTGGAGGTCCTCAGCGATCCCAAGACCCTGTTCCCGGACATGGAAGAGACCCTGCGCTCGCTGAAGCTGCTGGTCGCCGACGGGTTCCAGGTCATGGTCTACTGCTCGGACGACCCGGTCTACGCGCGCAAGCTGGAAGAGGCGGGCGCGGTGGCCATCATGCCGCTGGGCGCGCCGATCGGCTCGGGCCTCGGCATCCAGAACCGCGTCAACCTGCGGATCATCATCGAGAACGCC---AAGGTGCCGGTGCTGGTCGACGCAGGCGTCGGCACGGCGTCGGACGCGGCGATCGGCATGGAGCTGGGCTGCGACGCCATCCTGATGAACACCGCCATCGCTGAGGCCAAGGACCCGATCCGCATGGCCAAGGCGATGAAGCACGCCGTCATTGCCGGCCGCGAGGCCTATCTCGCCGGCCGGATGCAGAAACGCCTC...TACGCCGATCCCAGCTCGCCGCTGGCGGGGCTGATC---
TRN  11011101101011011
NAM  THIG_AQUAE/12-265
ASQ  YLEIAGRKFKSRLIIGSGKFKDFQQTKEVLEASGAEIITVAVRRVNITD-PTKENLLDYIDPKKYLILPNTAGCYTAEEAIKTAMMAREAT------GINWVKLEVIGDQKTLLPDMEETYKAAKVLVKEGFVVLPYIFDDPVFAKKFEDIGCAAVMPLAAPIGSGLGLQNPYNLIFIKEAV-SVPVIVDAGIGSATDIPPVMELGVDGVLTNTALAEAKDPIKMAVAMKYATIAGRLAYLAGRMPKRT.YAVPSSPTKGVPF
DSQ  TACTTGGAGATTGCGGGAAGAAAGTTCAAATCCCGCTTAATAATAGGCTCCGGTAAGTTTAAAGACTTCCAGCAAACTAAGGAAGTTCTGGAAGCGTCCGGAGCGGAAATAATAACCGTTGCCGTAAGAAGGGTAAATATAACGGAT---CCCACCAAGGAAAACCTCCTCGATTACATAGACCCTAAGAAGTACTTAATACTCCCAAATACCGCTGGATGTTACACGGCGGAGGAAGCCATAAAGACCGCTATGATGGCGAGGGAAGCTACG------------------GGTATAAACTGGGTAAAGCTTGAAGTTATAGGTGACCAAAAGACACTCCTTCCCGACATGGAGGAGACTTACAAGGCTGCTAAGGTACTCGTAAAAGAGGGATTTGTGGTTCTACCATACATTTTTGACGACCCCGTTTTTGCAAAAAAATTTGAAGACATAGGCTGTGCTGCGGTTATGCCTCTGGCGGCACCTATAGGCTCGGGTCTCGGGCTACAAAATCCCTATAACCTGATATTCATAAAGGAAGCAGTT---TCTGTTCCCGTTATAGTTGACGCGGGTATAGGAAGCGCTACCGATATACCGCCCGTTATGGAACTCGGTGTGGACGGAGTACTCACGAATACCGCCCTCGCGGAGGCAAAAGATCCTATAAAGATGGCCGTGGCTATGAAGTACGCAACAATCGCCGGAAGACTTGCTTACCTTGCCGGAAGGATGCCGAAGAGAACT...TACGCAGTTCCCTCTTCACCCACCAAGGGCGTTCCCTTC
TRN  10010101100011000
NAM  THIG_BACHD/5-258
ASQ  PLSIGGKTLTSRFFLGTGRYPNPFVQNEVIRVSEAEVLTFAIRRVNLQA-PGEDAILQHLEGKTFTYLPNTSGAKNAEEAIRIARLARASG------LSDWIKVEISVNERTLLPDPVETLRATETLANEGFTVLPYTSDDPVLCKRLEEAGAAAVMPGGAPIGTGLGILNPYNLGLIVEEA-NVPIIVDAGLGSAQDVVQAMELGADGVLMNTPVAKAKDPVKMALAMKHAIEAGRLSYLAGRIPKKR.YATASSGLETFIS
NAM  THIG_BACSU/3-256
ASQ  MLTIGGKSFQSRLLLGTGKYPSFDIQKEAVAVSESDILTFAVRRMNIFE-ASQPNFLEQLDLSKYTLLPNTAGASTAEEAVRIARLAKASG------LCDMIKVEVIGCSRSLLPDPVETLKASEQLLEEGFIVLPYTSDDVVLARKLEELGVHAIMPGASPIGSGQGILNPLNLSFIIEQA-KVPVIVDAGIGSPKDAAYAMELGADGVLLNTAVSGADDPVKMARAMKLAVEAGRLSYEAGRIPLKQ.YGTASSPGEGLPV
DSQ  ATGTTAACAATTGGCGGAAAATCATTTCAATCAAGATTGCTGCTGGGCACGGGGAAATACCCATCGTTTGACATTCAAAAGGAAGCAGTAGCTGTTTCTGAGTCTGATATTTTAACATTTGCTGTAAGGAGAATGAACATTTTTGAA---GCATCTCAGCCGAATTTTCTGGAACAGCTTGATTTATCCAAATATACGCTTTTGCCGAATACAGCGGGCGCCAGTACTGCTGAAGAAGCGGTTCGGATTGCAAGGCTGGCGAAAGCTTCAGGC------------------CTTTGTGACATGATTAAAGTTGAAGTCATCGGATGCAGCCGTTCCTTGCTGCCTGACCCTGTTGAGACATTAAAAGCGTCTGAACAGCTTCTTGAAGAAGGCTTTATTGTGCTCCCGTACACGTCGGATGACGTTGTGCTGGCGAGAAAGCTGGAAGAGCTCGGCGTTCATGCCATCATGCCGGGTGCATCTCCGATTGGATCAGGACAAGGAATCTTAAATCCTTTGAATCTGTCGTTTATTATTGAACAGGCG---AAAGTACCGGTCATCGTGGATGCGGGAATCGGCTCGCCTAAAGATGCGGCATACGCAATGGAGCTTGGAGCGGATGGCGTACTGCTCAATACGGCTGTATCTGGCGCTGACGATCCCGTGAAAATGGCTCGTGCCATGAAGCTCGCAGTGGAAGCAGGGCGCCTTTCTTATGAGGCGGGCCGAATCCCGCTTAAGCAA...TACGGAACGGCAAGCAGTCCGGGAGAAGGTCTTCCTGTA
TRN  10010101100011000
NAM  THIG_DEIRA/6-259
ASQ  LLTIGGQSFSSRLLLGTGKYRDFAVMQDALGASGTQIVTVAIRRVELKA-PGHDGLLDALDLDRFQLLPNTAGCRTAEEAVRVAKLARAAT------GVSWLKLEVIPDPKYLLPDPIGTLRAAEILVGEGFTVLPYVQPDGVLARALEAVGCATVMPLASPIGTGKGLRTPELIRTVIDGA-GVPIVVDAGLGVPSDAAQALELGADAVLVNTAIAEARDPVAMARAFALGVEAGRLGYLAGRMQQRD.SASPSSPAAGVVR
NAM  THIG_SYNY3/397-656
ASQ  LLEIAGRKFHSRLMTGTGKYPSLTTMQESVASSGCQIVTVAVRRVQTNA-PGHEGLAEAIDWSTIWMLPNTAGCQTAEEAIRVARLGREMAKLLGQEDNNFIKLEVIPDTQYLLPDPIGTLEAAEQLVKEGFAVLPYINADPLLAKRLEEVGCATVMPLGSPIGSGQGIRNAANIGIIIENA-KVPVVVDAGIGTPSEAAQAMEMGADAVLINSAIAMAANPVAMAQAMGMATQAGRLAYLSGRMPIKA.KANASSPLTGLVG
DSQ  TTGCTAGAAATTGCTGGCCGTAAATTCCACTCCCGCCTAATGACGGGCACCGGCAAATATCCTTCCCTCACCACCATGCAGGAAAGCGTCGCTAGCAGTGGTTGTCAGATTGTCACCGTGGCAGTGCGCCGAGTACAAACCAATGCC---CCAGGCCACGAGGGATTAGCGGAAGCCATTGATTGGTCCACCATTTGGATGCTCCCCAACACCGCTGGTTGTCAAACGGCCGAGGAAGCTATTCGGGTAGCCCGGTTGGGAAGGGAAATGGCTAAGTTACTGGGCCAGGAAGATAATAATTTCATCAAGCTAGAAGTCATTCCCGATACCCAATACCTCTTACCAGACCCCATTGGCACCCTCGAGGCGGCAGAACAGTTGGTTAAGGAAGGTTTTGCCGTACTGCCCTATATCAACGCTGATCCCTTATTGGCGAAAAGGCTGGAAGAAGTGGGCTGTGCCACTGTGATGCCCCTTGGTTCCCCCATCGGTTCTGGGCAGGGTATCCGTAACGCCGCCAACATTGGCATCATTATTGAGAATGCC---AAGGTTCCCGTGGTGGTGGATGCGGGCATTGGCACCCCCAGTGAAGCAGCCCAAGCAATGGAAATGGGCGCTGATGCGGTGTTGATCAACAGTGCGATCGCCATGGCGGCCAATCCCGTGGCCATGGCCCAGGCTATGGGAATGGCTACCCAAGCAGGGAGGCTCGCCTATCTGTCGGGCAGAATGCCCATTAAAGCC...AAGGCCAATGCCAGTTCTCCCCTCACGGGCCTAGTGGGT
TRN  10010101100011010
NAM  THIG_CYACA/29-289
ASQ  DFCIKNKKFQSRLILGTGRYRSLLEAKQSIEASGCDIVTVAIRRINADNIGFIKSLIKLINWQKYWLLPNTAGCQTAEEAIRVANLGQEIAKQLGQVDNNFVKLEVIPANKYLFPDPIGTLKAAEHLVKQGFVVLPYINSDPILAKQLEDIGCSAVMPLASAIGSGQGLKNIDNIRIIVEAS-KVPVIVDAGIGVPSEATQVMEIGADAVLINTAVAQCKVPVAMANAMRLAVAAGYEAHSAGRIPIKN.YARTSSPNFDRIG
DSQ  GATTTTTGCATAAAAAATAAAAAATTTCAATCCCGTCTAATCTTAGGTACAGGTAGATATAGAAGCTTATTAGAGGCTAAACAAAGTATAGAGGCTAGTGGATGCGACATTGTGACTGTGGCGATTAGAAGAATTAATGCCGATAACATTGGTTTTATAAAAAGTTTAATCAAGTTAATTAATTGGCAAAAATATTGGCTTTTGCCTAATACCGCTGGGTGTCAAACAGCCGAAGAAGCAATTAGAGTCGCAAATCTTGGACAAGAAATTGCTAAACAACTTGGACAGGTCGATAATAATTTCGTCAAGCTTGAAGTTATACCTGCTAACAAATATTTATTTCCTGATCCTATAGGCACATTAAAAGCCGCTGAGCATCTTGTAAAGCAAGGTTTTGTGGTTTTACCCTACATTAATTCAGATCCTATTTTGGCCAAGCAGCTGGAAGATATAGGGTGTTCGGCGGTTATGCCGTTAGCTTCAGCTATTGGATCAGGACAAGGATTAAAGAACATCGATAATATAAGAATTATAGTTGAAGCTTCT---AAAGTCCCAGTAATAGTAGATGCAGGAATCGGCGTTCCTAGTGAAGCGACACAAGTAATGGAAATAGGAGCAGATGCTGTCTTAATCAATACAGCAGTTGCTCAGTGTAAAGTTCCTGTTGCTATGGCTAATGCTATGCGATTAGCTGTAGCTGCAGGGTACGAAGCTCATTCTGCGGGTAGAATTCCAATTAAAAAT...TATGCTCGTACAAGTTCCCCTAATTTTGATAGAATAGGA
TRN  10010101100011000
NAM  THIG_PORPU/17-277
ASQ  QFKISDKSFSSRLMLGTGKYKNLQDAINSINVSGANIVTVAIRRAQNTKNLGRTNLIDGLDWSKLWILPNTAGCESAEEAVRIASLGQEIVKKLGQFDNNFIKLEVIPDSRYLLPDPIGTLKAAEYLINKGFVVMPYIGADPVLAKQLENIGCATVMPLASPIGSGKGLRNLLNLKIIIENA-KIPVIIDAGIGTPSEAGKVMELGASAVLVNTAIARAKNSQTMARAMSLAVESGRLTYIAGRMPISE.KAEPSSPILGISK
DSQ  CAATTCAAAATAAGTGATAAAAGTTTTAGTTCCAGATTGATGCTAGGGACAGGTAAATATAAAAATCTACAAGATGCAATTAATAGTATAAATGTTAGCGGTGCAAATATTGTTACAGTTGCTATAAGAAGAGCTCAAAATACCAAAAATTTAGGCCGTACTAATCTTATTGATGGTCTAGACTGGTCTAAACTCTGGATTTTGCCAAACACAGCTGGCTGTGAAAGTGCAGAAGAGGCAGTTCGTATAGCTTCTCTAGGTCAAGAAATAGTCAAAAAATTAGGTCAATTTGATAATAATTTTATTAAATTAGAAGTAATACCAGATTCTCGCTATTTATTGCCTGATCCAATAGGTACCTTAAAAGCTGCTGAATATTTAATAAATAAAGGCTTTGTTGTAATGCCATATATTGGTGCAGATCCAGTATTAGCAAAACAACTTGAAAATATTGGTTGTGCTACAGTTATGCCATTAGCATCTCCAATTGGTTCAGGTAAAGGTTTGAGAAACCTTCTTAATTTAAAAATCATTATAGAAAATGCA---AAAATCCCTGTTATTATAGATGCAGGAATTGGTACTCCAAGTGAAGCAGGAAAAGTTATGGAGCTTGGTGCTTCTGCAGTGTTAGTTAATACCGCAATTGCTCGTGCAAAGAACTCTCAAACAATGGCTCGAGCTATGAGCCTTGCAGTAGAATCCGGTAGACTAACTTATATTGCAGGCCGAATGCCAATAAGTGAA...AAAGCAGAACCTAGTTCTCCTATATTAGGTATATCTAAA
TRN  10010101110011000
NAM  THIG_ODOSI/7-261
ASQ  TLKIGNKTFNSRLMLGSGKYRTIENAVNSIITSDCEILTVAVRRLPTKLTNDNTSFLKSLDWNKLWLLPNTAGSQTAEEAIRMAFLGHELACQLGQEDNFFVKLEVISDPKYLLPDPIGTLKAAEFLVKKGFTVLPYINADPMLALHLEDLGCATVMPLGSPIGSGQGLNNISNLQIIIENS-SIPVIIDAGIGTPSEAAKSMELGADGVLLNTAIAQAKTPEKMALAMKLAVEAGRLGYLAGRMEKNR.MQVQVLH------
DSQ  ACATTAAAAATCGGAAATAAAACTTTTAACTCTAGATTAATGCTAGGAAGTGGGAAATACCGAACAATTGAAAATGCTGTTAATAGTATTATAACTAGTGATTGCGAAATTTTAACTGTTGCTGTTCGACGATTACCGACTAAGCTGACTAATGACAATACTAGTTTTTTAAAGTCTTTGGATTGGAATAAATTATGGTTATTACCAAACACCGCAGGTTCACAAACAGCGGAAGAAGCAATTCGAATGGCATTTTTAGGACACGAATTAGCATGTCAACTAGGACAAGAGGATAATTTCTTTGTTAAACTTGAAGTAATTTCTGATCCAAAATATTTATTACCTGATCCAATTGGAACATTAAAAGCCGCAGAATTTTTAGTAAAAAAGGGCTTCACAGTTTTACCTTATATCAACGCTGATCCCATGTTAGCATTACATTTAGAAGATTTAGGGTGTGCGACAGTTATGCCCTTAGGATCTCCTATTGGTTCAGGACAAGGATTAAATAATATCTCTAATCTTCAGATTATCATTGAAAATTCT---AGTATACCTGTTATTATTGATGCGGGTATTGGGACACCTAGTGAAGCAGCAAAGTCAATGGAATTAGGTGCTGATGGAGTTTTATTAAATACTGCTATAGCACAAGCTAAAACGCCAGAGAAAATGGCATTAGCTATGAAATTAGCAGTAGAAGCTGGCCGTTTAGGTTATTTGGCAGGTCGAATGGAAAAAAATCGT...ATGCAAGTCCAAGTTCTCCAT------------------
TRN  10010101100011000
NAM  THIG_VIBCH/1-253
ASQ  MLKIADKTFQSRLFTGTGKFSNRHVMAEALAASGSELVTMALKRIDLAQR--DDDILAPLLSMQMNLLPNTSGAKNAADAVYAAELAREAL------ATNWLKLEIHPDPKYLMPDPIETLLAAEQLVKQGFIVLPYCHADPVLCKRLEEVGCAAVMPLGSPIGSNQGLASKTFLEIIIDQA-KVPVIVDAGIGSPSDAAQAMELGADAVLVNTAIAAAHDPIAMAKAFKLAVEAGRMAYESGLPSRVK.MATASSPLTGFLD
DSQ  ATGCTCAAGATTGCAGATAAAACGTTTCAATCCAGACTGTTTACTGGGACTGGAAAATTCTCTAATCGCCATGTCATGGCTGAAGCATTGGCCGCCTCAGGTTCAGAGTTGGTGACCATGGCGTTAAAGCGGATTGATTTGGCTCAGCGC------GACGATGACATTCTTGCGCCGCTACTCAGTATGCAGATGAATCTCTTACCTAACACATCTGGAGCCAAAAATGCTGCTGATGCGGTGTATGCCGCCGAGCTAGCCCGAGAAGCCTTA------------------GCCACGAACTGGCTTAAGTTGGAGATTCATCCTGATCCCAAATATCTAATGCCCGATCCCATCGAAACCCTGCTTGCGGCAGAACAATTGGTGAAGCAAGGTTTTATTGTGTTGCCGTATTGTCATGCTGACCCTGTCTTGTGCAAAAGATTGGAAGAGGTTGGCTGCGCTGCGGTTATGCCCCTCGGTTCACCGATTGGCAGCAATCAAGGCTTGGCGTCGAAAACCTTTCTTGAAATCATCATTGACCAAGCC---AAGGTGCCGGTCATTGTCGATGCGGGGATTGGGTCGCCATCCGATGCTGCGCAAGCGATGGAGCTTGGCGCCGACGCTGTGTTAGTGAATACCGCTATTGCCGCGGCGCATGACCCCATCGCTATGGCAAAAGCCTTTAAGCTAGCGGTCGAAGCTGGGCGAATGGCTTATGAATCCGGCTTGCCATCACGAGTAAAA...ATGGCGACGGCATCAAGTCCATTAACTGGATTTTTGGAT
TRN  10010101100011000
NAM  THIG_ECOLI/1-253
ASQ  MLRIADKTFDSHLFTGTGKFASSQLMVEAIRASGSQLVTLAMKRVDLRQH--NDAILEPLIAAGVTLLPNTSGAKTAEEAIFAAHLAREAL------GTNWLKLEIHPDARWLLPDPIETLKAAETLVQQGFVVLPYCGADPVLCKRLEEVGCAAVMPLGAPIGSNQGLETRAMLEIIIQQA-TVPVVVDAGIGVPSHAAQALEMGADAVLVNTAIAVADDPVNMAKAFRLAVEAGLLARQSGPGSRSY.FAHATSPLTGFLE
DSQ  ATGTTACGTATTGCGGACAAAACGTTTGATTCACATCTGTTTACCGGCACAGGGAAATTCGCTTCTTCACAACTGATGGTGGAGGCGATCCGCGCTTCCGGCAGCCAGCTGGTGACACTGGCGATGAAACGTGTCGACTTGCGCCAGCAC------AACGACGCTATCCTCGAACCGCTTATCGCGGCGGGTGTGACCCTGCTGCCAAATACATCCGGGGCGAAAACAGCGGAAGAAGCCATTTTCGCCGCCCATCTGGCTCGTGAAGCGTTA------------------GGCACAAACTGGTTAAAATTAGAGATTCACCCTGACGCCCGCTGGCTGTTGCCCGATCCCATCGAAACCCTGAAAGCCGCCGAAACGCTGGTACAACAGGGATTTGTCGTGCTGCCTTACTGCGGGGCCGATCCGGTATTGTGTAAACGTCTGGAAGAAGTCGGCTGTGCAGCGGTGATGCCGCTCGGCGCGCCGATTGGCTCGAATCAGGGACTGGAAACCCGCGCCATGCTGGAGATTATTATCCAGCAGGCC---ACAGTGCCGGTGGTTGTCGATGCTGGCATCGGCGTTCCCAGCCATGCCGCGCAGGCGCTGGAAATGGGGGCCGACGCGGTGTTAGTGAATACGGCGATTGCCGTCGCGGACGATCCCGTCAACATGGCGAAGGCATTTCGTCTGGCGGTAGAAGCAGGCCTACTGGCACGTCAGTCCGGACCGGGCAGCCGCAGTTAT...TTTGCTCATGCCACCAGCCCGCTGACCGGATTTCTGGAG
TRN  11011101101011000
NAM  THIG_CHLTE/3-256
ASQ  SLRLGTYTFSSRLILGTGKFSSTSAMIKAVRASGTQLVTVALRRFNREQAE-DDLFGPLSEIEGLTLMPNTSGAATAKEAIKAAHIARELS------GSPFIKVEIHPNPHHLMPDPIETWEACKILAAEGFIVMPYIPADPVLAKRLEEVGCSSVMPLGSAIGSGQGLSTAEMVKIIIRES-SVPVIVDAGLRSPSEACAAMEMGCEAVLVNSAVAVARDPAAMALAFAKAVEAGFEARNAGLMPRSG.SAVATSPLTSFLG
DSQ  TCACTTCGCTTAGGCACATACACCTTCTCATCCCGCCTGATTCTCGGCACCGGCAAATTCAGCAGCACTTCGGCGATGATCAAGGCCGTCCGCGCGTCGGGTACGCAGCTCGTTACCGTGGCGTTGAGACGTTTCAATCGCGAACAGGCCGAG---GATGATCTGTTCGGCCCGCTGTCGGAAATCGAGGGACTCACGCTGATGCCTAACACCTCCGGCGCGGCGACGGCCAAAGAGGCCATCAAGGCGGCGCACATTGCGCGCGAACTCTCC------------------GGCAGCCCGTTCATCAAGGTCGAGATTCACCCGAACCCGCACCACCTGATGCCCGACCCGATCGAGACCTGGGAAGCGTGCAAGATTCTCGCCGCAGAAGGGTTCATCGTCATGCCCTACATTCCGGCGGATCCGGTGCTGGCCAAGCGCCTCGAAGAGGTGGGGTGCAGCTCGGTAATGCCGCTCGGCTCGGCCATCGGCAGCGGGCAGGGACTTTCGACCGCCGAGATGGTGAAAATCATCATCCGCGAGAGC---TCGGTTCCGGTGATTGTCGATGCGGGTTTGCGCTCGCCATCAGAAGCGTGCGCGGCGATGGAGATGGGATGCGAGGCGGTGCTGGTGAACAGCGCCGTGGCGGTCGCCCGCGATCCGGCGGCGATGGCGCTGGCCTTCGCCAAGGCGGTCGAGGCGGGATTCGAGGCACGGAACGCAGGGCTGATGCCACGTTCGGGA...TCGGCGGTCGCAACCAGCCCGCTCACCTCGTTCCTGGGA
TRN  10010101100011000
NAM  THIG_CAMJE/9-257
ASQ  KLKIGKYEFDSRFILGSGKY-SLELIKSAIEEAKAQIITLALRRANTGEIA---NILDYIP-KNITLLPNTSGARNADEALRIARLSRELG------CGELIKIEVISDSRYLLPDNYETIKACELLAKEGFTPLPYMHADLYAARAMRDAGAAAIMPLAAPIGSNKGLCAKEFIQILLNEI-DLPIIVDAGIGSPSQACEAMQMGVSAVMVNTAIAEAKDIALMARAFSLAVNAGRVAFLAGVASVS-.EAKASSPLTGFLR
DSQ  AAATTAAAAATAGGCAAATACGAGTTTGATTCAAGATTTATTTTAGGTTCTGGAAAATAT---TCGCTAGAGCTTATAAAATCAGCTATAGAAGAAGCTAAAGCACAGATTATCACTCTAGCCTTACGCCGTGCAAATACAGGGGAAATTGCT---------AATATACTTGATTATATCCCT---AAAAATATCACACTTTTACCCAACACTTCAGGCGCAAGAAACGCCGATGAAGCCTTACGCATTGCAAGGCTTTCAAGAGAGCTTGGT------------------TGTGGAGAACTTATCAAAATAGAAGTGATAAGTGATAGTAGGTATTTATTGCCTGATAATTATGAAACGATTAAAGCTTGTGAGCTTTTAGCTAAAGAGGGTTTTACGCCCCTACCTTACATGCATGCTGATCTTTACGCAGCTAGAGCTATGCGTGATGCTGGAGCTGCGGCTATCATGCCTTTAGCAGCGCCTATTGGGAGTAATAAAGGTTTATGTGCTAAGGAATTTATACAAATTTTGCTTAATGAAATT---GATTTGCCTATCATTGTAGATGCGGGTATTGGAAGTCCTTCACAAGCTTGTGAAGCTATGCAAATGGGAGTAAGTGCAGTGATGGTAAATACAGCCATAGCTGAAGCTAAAGATATAGCCTTGATGGCTAGAGCTTTTTCTTTGGCGGTAAATGCGGGAAGAGTGGCTTTTTTAGCAGGTGTGGCAAGTGTGAGT---...GAAGCTAAAGCAAGTTCTCCATTAACAGGCTTTTTAAGG
TRN  10010101110011000
NAM  THIG_FUSNN/4-254
ASQ  SFKLGNKEFNSRFILGSGKY-SNELINSAINYAEAEIVTVAMRRAVSGV---QENILDYIP-KNITLLPNTSGARNAEEAVKIARLARECI------QGDFIKIEVIKDSKYLLPDNYETIKATEILAKEGFIVMPYMYPDLNVARALRDAGASCIMPLAAPIGSNRGLITKEFIQILIDEI-DLPIIVDAGIGKPSQACEAIEMGVTAIMANTAIATANDIPRMARAFKYAIQAGREAYLAKLGRVLEkGASASSPLTGFLN
DSQ  AGTTTTAAACTTGGTAATAAAGAATTTAATTCAAGATTTATTCTTGGTTCAGGTAAATAT---TCAAATGAATTAATAAACAGTGCTATTAACTATGCAGAAGCTGAAATAGTAACTGTTGCAATGAGAAGGGCTGTCAGTGGAGTT---------CAAGAAAATATTTTAGACTATATTCCT---AAGAATATAACTTTACTTCCTAATACTTCTGGTGCAAGAAATGCAGAAGAAGCAGTGAAAATAGCAAGACTTGCAAGAGAGTGTATT------------------CAAGGAGATTTTATAAAAATTGAGGTAATCAAAGATAGTAAATATCTTTTACCTGATAACTATGAAACTATAAAGGCAACTGAAATCTTAGCAAAAGAAGGTTTTATTGTTATGCCATATATGTATCCAGATTTGAATGTTGCAAGAGCTTTAAGGGATGCAGGAGCAAGTTGTATAATGCCACTTGCTGCCCCAATAGGATCTAATAGGGGCTTAATAACAAAAGAATTTATACAGATTTTAATAGATGAGATA---GATTTACCAATAATAGTTGATGCAGGTATAGGAAAACCTTCACAGGCTTGTGAAGCAATAGAAATGGGAGTAACTGCAATTATGGCTAATACTGCAATAGCAACTGCAAATGATATTCCAAGAATGGCAAGGGCTTTTAAGTATGCAATACAAGCTGGGAGAGAAGCTTATCTTGCAAAATTAGGTAGAGTTTTAGAAaagGGTGCTTCTGCTTCTTCACCACTTACTGGATTTTTAAAT
TRN  10010101110011000
NAM  THIG_CLOPE/3-254
ASQ  KLIIGGIEIKNRLFVGSGKYPSNEIIKDVLEGSGSQVITLALRRVDLDNK--EEDILQNIP-KDVILLPNTSGATNAEEAIRIARIARAMG------CGNWIKIEVISDSKYLLPDNEETIKATKVLADEGFIVLPYMCPDIYAGRRLIEAGAAAVMPLGAPIGSNRGLKTKELIQIMIDEL-DIPIIVDAGIGKPSQAMEAMEMGAAACLVNTAIASSEDPINMARAFKVAVEGGRLAYEAKMGRESK.FGNASSPLTGFLD
DSQ  AAGTTAATAATAGGTGGAATAGAAATAAAAAATAGACTTTTTGTTGGAAGTGGTAAATATCCTTCAAATGAAATAATAAAGGATGTTTTAGAGGGAAGTGGCTCTCAAGTTATAACTTTAGCCTTAAGAAGGGTAGATTTAGATAATAAG------GAAGAGGATATTCTTCAAAATATACCT---AAGGATGTAATACTACTTCCTAATACTTCTGGGGCAACTAATGCAGAGGAGGCTATTAGAATAGCAAGGATAGCAAGAGCTATGGGA------------------TGTGGAAACTGGATAAAGATAGAAGTTATATCAGATTCTAAGTATTTGCTTCCAGATAATGAAGAAACCATAAAGGCAACTAAGGTATTAGCTGATGAAGGCTTTATTGTCCTTCCTTATATGTGTCCTGATATTTATGCAGGAAGAAGGTTAATAGAAGCTGGAGCGGCAGCTGTAATGCCACTTGGTGCACCAATAGGAAGTAATAGAGGGTTAAAGACTAAAGAATTGATTCAAATAATGATAGATGAATTA---GATATTCCTATTATAGTTGACGCAGGTATAGGAAAGCCATCACAGGCTATGGAAGCTATGGAAATGGGAGCTGCAGCTTGTTTAGTTAATACTGCTATAGCATCCTCAGAAGATCCTATAAATATGGCTAGAGCTTTTAAAGTGGCAGTAGAAGGTGGCAGATTAGCTTATGAAGCTAAAATGGGAAGAGAATCAAAG...TTTGGAAATGCTTCATCTCCACTTACTGGATTTTTAGAT
TRN  10010101110011000
NAM  THIG_CLOAB/3-255
ASQ  ELEIGGVKLDSRLFVGTGKLASNEVIPKIMEKSNSKVITVALRRVDITSK--QDNILNFID-KDLILLPNTSGARNAEEAIRLARIAKAAG------CGNWIKIEVISDNKYLLPDNYETIKATEALVKEGFIVLPYVNPDLMDARRLVNVGAAAVMPLGAPIGSNRGLRTKEMLKILIEEINEVPVVVDAGIGKPSDAAMAMEMGADAVLVNTAIATADNPVLMAEAFSLAVKAGRMAYVAKIGEEKE.YASASSPLTGFLR
DSQ  GAATTAGAAATAGGTGGAGTTAAACTAGATAGTAGACTTTTTGTTGGGACAGGTAAATTGGCCTCTAATGAAGTTATACCAAAAATCATGGAAAAATCAAATTCAAAGGTTATAACAGTAGCACTTAGAAGAGTTGACATAACTTCAAAG------CAGGATAATATTTTGAATTTTATAGAT---AAGGATTTAATACTTTTACCAAATACATCAGGAGCTAGAAATGCAGAGGAGGCTATTAGACTTGCAAGAATAGCTAAGGCAGCAGGT------------------TGTGGAAACTGGATTAAGATAGAGGTTATATCGGATAATAAATATTTACTTCCAGATAATTATGAAACGATAAAGGCAACAGAGGCTTTGGTAAAGGAAGGTTTTATAGTACTTCCATATGTAAATCCTGACCTTATGGATGCAAGAAGACTTGTAAATGTCGGAGCAGCAGCAGTTATGCCACTGGGAGCACCAATTGGAAGTAATAGAGGACTTAGAACTAAGGAAATGCTTAAAATATTAATAGAAGAAATAAATGAAGTTCCTGTAGTTGTAGATGCGGGAATAGGAAAACCATCAGATGCTGCTATGGCTATGGAGATGGGAGCAGATGCGGTACTTGTAAATACGGCTATAGCAACAGCAGATAATCCAGTATTAATGGCAGAAGCATTCTCTTTGGCAGTTAAAGCAGGAAGAATGGCCTATGTTGCAAAAATAGGAGAGGAAAAAGAA...TACGCATCAGCATCTTCTCCTCTTACAGGATTTTTAAGA
TRN  10010101100011000
NAM  THIG_NEIMA/1-256
ASQ  MLTLYSETFPSRLLLGTAAYPTPEILKQSVRTARPAMITVSLRRAGCGGEAHGQGFWSLLQETGVPVLPNTAGCQSVQEAVTTAQMAREVF------ETDWIKLELIGDDDTLQPDVFQLVEAAEILIKDGFKVLPYCTEDLIACRRLLDAGCQALMPWAAPIGTGLGAVHAYALNVLRERLPDTPLIIDAGLGLPSQAAQVMEWGFDGVLLNTAVSRSGDPVNMARAFALAVESGRLAFEAGPVEARD.KAQASTPTVGQPF
DSQ  ATGCTCACCCTGTACAGCGAAACTTTCCCTTCGCGGCTGCTGCTCGGCACAGCCGCCTACCCGACCCCTGAAATCCTCAAACAATCCGTCCGAACCGCCCGGCCCGCGATGATTACCGTCTCGCTGCGCCGCGCGGGATGCGGCGGCGAGGCGCACGGTCAGGGGTTTTGGTCGCTGCTTCAAGAAACCGGCGTTCCCGTCCTGCCGAACACGGCAGGCTGCCAAAGCGTGCAGGAAGCGGTAACGACGGCGCAAATGGCGCGCGAAGTGTTT------------------GAAACCGATTGGATTAAACTCGAACTCATCGGCGACGACGACACCTTGCAGCCGGATGTGTTCCAACTTGTCGAAGCGGCGGAAATCCTGATTAAAGACGGCTTCAAAGTGCTGCCTTATTGCACCGAAGACCTGATTGCCTGCCGCCGCCTGCTCGACGCGGGCTGTCAGGCGTTGATGCCGTGGGCGGCCCCGATCGGCACGGGTTTGGGCGCGGTTCACGCCTACGCGTTGAACGTCCTGCGCGAACGCCTGCCCGACACGCCGCTGATTATCGACGCGGGCTTGGGTTTGCCCTCACAGGCGGCACAAGTGATGGAATGGGGCTTTGACGGCGTGCTTTTGAATACTGCCGTTTCCCGCAGCGGCGATCCGGTCAATATGGCACGCGCCTTCGCACTCGCCGTCGAATCCGGACGGCTGGCATTTGAAGCCGGACCGGTCGAAGCACGCGAC...AAAGCGCAAGCCAGCACGCCGACAGTCGGACAACCGTTT
TRN  11011101101011001
NAM  THIG_RALSO/12-267
ASQ  PLRLYDEVFGSRLLLGTARYPSPQSLEDAVRACGPAMLTVALRRQSAGTPEGGAGFWKMLRALGVPVLPNTAGCYSADEAYTLAQMSREVF------ETDWIKLEVIGDDYTLQPDTLALPAAAERLIRDGFKVLPYCTEDLVLCRRLLDVGCRALMPWAAPIGTGRGPTNPYGLRLLRERLPDVPLIVDAGLGVPSHATQVMEWGYDGVLLNTAVAQAGDPVAMARAFAMATQAGRLARLSGPMPERD.VAQASTPVVGLPF
DSQ  CCGCTGCGGCTGTATGACGAAGTCTTCGGCTCGCGGCTGCTGCTGGGCACCGCGCGCTATCCGTCGCCGCAATCGCTGGAAGACGCGGTGCGCGCGTGCGGCCCGGCCATGCTGACCGTGGCGCTGCGCCGCCAGAGCGCCGGCACACCCGAAGGCGGCGCGGGCTTCTGGAAGATGCTGCGCGCGCTGGGCGTGCCCGTGCTGCCCAACACGGCCGGCTGCTACTCCGCCGACGAGGCCTACACGCTCGCGCAGATGTCGCGCGAAGTGTTC------------------GAGACCGACTGGATCAAGCTCGAAGTCATCGGCGACGACTACACGCTGCAGCCCGACACGCTAGCGCTGCCTGCGGCCGCCGAACGCCTGATCCGCGACGGCTTCAAGGTGCTGCCGTACTGCACCGAAGACCTTGTGCTGTGCCGCCGCCTGCTCGACGTCGGCTGCCGGGCGCTGATGCCGTGGGCCGCCCCCATCGGCACCGGGCGCGGGCCGACCAACCCGTACGGCCTGCGCCTGCTGCGCGAGCGCCTGCCCGACGTGCCGCTGATCGTCGATGCCGGCCTGGGCGTGCCGTCGCACGCCACGCAGGTGATGGAGTGGGGCTACGACGGCGTGCTGCTCAACACCGCCGTCGCGCAGGCGGGCGATCCGGTGGCGATGGCGCGCGCGTTCGCGATGGCCACGCAGGCCGGCCGCCTGGCGCGGCTGTCGGGCCCGATGCCGGAGCGCGAT...GTCGCGCAGGCGAGCACGCCGGTGGTCGGCCTGCCGTTC
TRN  11011111101111111
NAM  THIG_ERWAM/1-250
ASQ  --MFYDFVPQSRFLLGTAGYPSPQILQQAIEASGSEIITVSLRREGSQ----GGAFRALLTQLNKRVLPNTAGCHTVKEAVTTAYMARELF------NTRWIKLEVIGHADTLQPDPFALVEAARILCADGFQVFPYTTEDLILGEKLLEAGCKLLMPWGAPIGSGQGLRNIEGLRSMRSWFKDIPLIIDAGIGAPSQAAQAMEMGFDGILLNTAVARAQDPLGMAQAFASAIRAGYDARSAGLIERRD.MATASTPIFGMAQ
NAM  THIG_AGRT5/1-255
ASQ  MLTLYGREVSSRLLLGTARYPSPAVLADAVRASNTDILTISLRREMAGAKKG-GQFFELIRELDRHILPNTAGCHTAKEAVLTAKMAREVF------RTDWIKLEVIGHHDTLQPDVFALVEAAKILCDEGFEVFPYTTDDLVVAEKLLEAGCRVLMPWCAPIGSAMGPLNLTALKSMRARFPEVPLIVDAGIGRPSHAVTVMELGYDAVLLNTAVAGAGDPVGMAEAFARAIEAGHQAYLSGPLEPRD.MAVPSTPVIGTAV
DSQ  ATGCTGACGCTTTATGGCCGCGAGGTCTCGTCCCGCCTTCTGCTCGGCACGGCGCGTTATCCGTCTCCCGCTGTGCTTGCGGATGCGGTGCGGGCCAGCAATACGGATATTCTGACGATTTCGTTGCGACGGGAAATGGCAGGGGCCAAGAAGGGC---GGTCAGTTTTTCGAGCTGATCCGCGAGCTGGATCGCCATATCCTGCCCAATACGGCTGGTTGCCACACCGCCAAGGAAGCGGTGCTGACGGCGAAGATGGCCCGCGAGGTATTC------------------CGTACGGACTGGATCAAGCTGGAGGTCATTGGCCATCACGATACGTTGCAGCCCGATGTCTTTGCGCTTGTCGAGGCGGCAAAAATCCTGTGTGACGAGGGTTTCGAAGTCTTTCCCTATACGACGGACGATTTGGTCGTGGCCGAGAAACTGCTGGAGGCTGGTTGCAGGGTGCTGATGCCCTGGTGCGCGCCGATCGGCAGCGCCATGGGGCCGCTCAATCTGACGGCGCTGAAATCGATGCGGGCGCGGTTTCCCGAAGTACCACTGATCGTGGATGCCGGTATCGGCCGGCCCTCCCATGCGGTGACCGTGATGGAGCTTGGTTACGATGCCGTTCTCCTCAACACGGCGGTTGCGGGTGCGGGCGACCCAGTCGGCATGGCGGAGGCTTTTGCCCGCGCCATAGAGGCAGGCCATCAGGCGTATCTTTCGGGGCCGCTGGAGCCACGAGAC...ATGGCCGTTCCTTCGACCCCTGTTATCGGGACGGCGGTT
TRN  10010101100011011
NAM  THIG_RHIET/1-255
ASQ  MLKLYDVEVGSRLLLGTARYPSPAVLAEAVRRAKTEIVTVSLRREAAGGKAG-GAFFELIRELGVRVLPNTAGCHSVQEAVLTAKLARDVF------RTDWIKLEVIGHHDTLQPDVFGLVEAARILSGEGFQVFPYTTDDLVVAEKLLDAGCRVLMPWCAPIGSAMGPVNPMALRAFRAHFPDVPLIVDAGVGRPSHAAAVMEYGYDAVLLNTAVAGAGDPAAMAEAFALAIDAGRIAHSAVPLEPRD.MAVPSTPVIGKAV
NAM  Q8KJ35_RHILO/1-255
ASQ  MFELFGTSLPSRLLLGTAQYPSPAILADAVKASGTSVVTVSLRREMAGGRAG-EKFWSLIRALGTRILPNTAGCHSVKEAVTTAKMAREVF------GTSWIKLEVIGNQDTLQPDVFGLVEAARILCEDGFTVFPYTTDDLVVAERLLEAGCKVLMPWCAPIGSALGPVNIMALRSMRGHFPDVPLIVDAGLGRPSHAATVMELGFDAVLLNTAVARAADPVGMARAFGKAVEAGREAYSSGMLEPRD.VAVPSTPTIGRAV
DSQ  ATGTTCGAACTTTTCGGAACGTCGCTTCCCTCGCGGCTGCTTCTCGGCACGGCTCAGTATCCTTCACCGGCCATCCTTGCCGATGCGGTCAAGGCGTCGGGCACATCGGTGGTGACCGTCTCGTTGCGGCGTGAGATGGCAGGCGGGAGGGCCGGC---GAAAAATTCTGGTCGTTGATCCGCGCGCTCGGCACGAGAATCCTTCCCAACACTGCCGGCTGCCACTCCGTCAAGGAAGCGGTCACGACCGCGAAGATGGCGCGCGAAGTGTTC------------------GGCACGAGCTGGATCAAGCTCGAAGTGATCGGCAACCAGGACACGCTGCAACCGGACGTGTTCGGCCTGGTCGAAGCCGCGCGCATCCTGTGCGAGGACGGTTTTACGGTATTTCCCTATACCACCGACGACCTTGTTGTCGCCGAGCGGCTGCTGGAGGCGGGCTGCAAGGTCCTGATGCCGTGGTGCGCACCGATCGGTTCCGCCCTCGGGCCGGTCAACATCATGGCACTGCGTTCGATGCGCGGACACTTCCCGGATGTCCCGCTCATTGTGGATGCGGGGCTCGGACGGCCGTCGCACGCGGCAACCGTCATGGAACTCGGCTTTGACGCCGTGCTGCTGAACACGGCGGTCGCCAGGGCGGCTGATCCGGTCGGCATGGCGCGTGCGTTCGGCAAGGCTGTCGAAGCCGGCCGTGAAGCTTACAGCTCGGGAATGCTCGAACCGCGCGAC...GTCGCCGTGCCATCGACGCCGACAATTGGCAGAGCCGTT
TRN  10010101100011001
NAM  THIG_BRUME/1-255
ASQ  MLEFYGKRFESRLLLGTAQYPSPSILADAVRASLSRIVTVSLRRESGEARAG-QDFWALIKALGVAVLPNTAGCHTPREAITTAHMAREVF------GTNWIKLEVIGDTDTLQPDPFGLVEAARILCDEGFEVFPYMNDDLIVAERLIEAGCKVLMPWGAPIGSGRGFNNPYALKTMRAHFPDIPLVVDAGIGVPSHAAAAMELGFDAVLINTAVAKAGDPAAMARAFALAVEAGRLAYEADPIEARD.MASPSTPLLGKAF
//