EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05659 - RPW8)
FAM  PF05659
PID  RPW8
DES  Arabidopsis broad-spectrum mildew resistance protein RPW8
IPR  IPR008808
ANO  6
ALN  158
AID  0.519995
APH  ((Q9SCS9_ARATH/2-148:0.26730,Q9C5Z5_ARATH/2-148:0.19745):0.05309,Q9SCS7_ARATH/2-148:0.02500,((Q9SCS6_ARATH/2-152:0.58982,Q9C5Z7_ARATH/2-143:0.29379):0.47159,Q9C5Z6_ARATH/1-148:0.21135):0.13622);
ATP  ((Q9SCS9_ARATH/2-148,Q9C5Z5_ARATH/2-148),Q9SCS7_ARATH/2-148,((Q9SCS6_ARATH/2-152,Q9C5Z7_ARATH/2-143),Q9C5Z6_ARATH/1-148));
ATL  2.24561
DNO  6
DLN  474
DID  0.698554
DPH  ((Q9SCS9_ARATH/2-148:0.15922,Q9C5Z5_ARATH/2-148:0.08528):0.05967,Q9SCS7_ARATH/2-148:0.04389,((Q9SCS6_ARATH/2-152:0.25900,Q9C5Z7_ARATH/2-143:0.12108):0.18091,Q9C5Z6_ARATH/1-148:0.10814):0.06348);
DTP  ((Q9SCS9_ARATH/2-148,Q9C5Z5_ARATH/2-148),Q9SCS7_ARATH/2-148,((Q9SCS6_ARATH/2-152,Q9C5Z7_ARATH/2-143),Q9C5Z6_ARATH/1-148));
DTL  1.08067
RID  0.519995
RPH  ((Q9SCS9_ARATH/2-148:0.26730,Q9C5Z5_ARATH/2-148:0.19745):0.05309,Q9SCS7_ARATH/2-148:0.02500,((Q9SCS6_ARATH/2-152:0.58982,Q9C5Z7_ARATH/2-143:0.29379):0.47159,Q9C5Z6_ARATH/1-148:0.21135):0.13622);
RTP  ((Q9SCS9_ARATH/2-148,Q9C5Z5_ARATH/2-148),Q9SCS7_ARATH/2-148,((Q9SCS6_ARATH/2-152,Q9C5Z7_ARATH/2-143),Q9C5Z6_ARATH/1-148));
RTL  2.24561
LNK  Q9C5Z5_ARATH/2-148:Q9C5Z5:AF273059
LNK  Q9C5Z6_ARATH/1-148:Q9C5Z6:AF273059
LNK  Q9C5Z7_ARATH/2-143:Q9C5Z7:AF273059
LNK  Q9SCS6_ARATH/2-152:Q9SCS6:AL133363
LNK  Q9SCS7_ARATH/2-148:Q9SCS7:AL133363
LNK  Q9SCS9_ARATH/2-148:Q9SCS9:AL133363
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9C5Z5_ARATH/2-148
ASQ  PLTEI---------IAGAALGLALQILHEAIQRAKDRSLTTSCILDRLDSTILRITPLMAKVEKLNKESDES-LRKVFEDLKHLLEKAVVLVEAYAELK-RRNLLEKYRYKRRIKELEGSLKWMVDVDVKVNQWADIKDLMAKMSEMNTKLEKIMGQP
DSQ  CCTCTTACCGAGATT---------------------------ATCGCAGGGGCTGCTCTTGGACTTGCTCTCCAAATCCTTCACGAGGCCATCCAAAGAGCAAAAGATAGATCCTTAACCACAAGTTGTATCTTGGACCGTCTCGATTCTACAATCTTGAGGATCACTCCACTGATGGCTAAGGTCGAAAAGCTCAACAAAGAATCCGATGAATCT---CTGAGGAAAGTCTTCGAAGATCTTAAACATCTTCTCGAGAAAGCCGTGGTTCTTGTCGAAGCTTATGCGGAGCTCAAA---CGCAGAAACTTACTTGAAAAATATAGGTACAAGAGAAGAATCAAAGAGTTAGAAGGCTCATTGAAATGGATGGTAGATGTTGACGTTAAAGTCAATCAATGGGCAGATATCAAAGATCTTATGGCCAAGATGTCTGAAATGAACACTAAACTTGAAAAAATCATGGGTCAACCA
TRN  10010101100011000
NAM  Q9SCS7_ARATH/2-148
ASQ  PVSEI---------MAGAALGLALQVLHDAIKKAKDRSLTTRCILDRLDATIFRITPLVTQVDKLSEEVEDS-PRKVIEDLKHLLEKAVSLVEAYAELR-RRNLLKKFRYKRRIKELEASLRWMVDVDVQVNQWVDIKELMAKMSEMNTKLDEITRQP
DSQ  CCGGTTAGTGAGATT---------------------------ATGGCAGGGGCAGCTCTTGGACTTGCTCTCCAAGTCCTTCACGATGCCATCAAAAAAGCAAAAGATAGATCTCTAACTACAAGATGCATCTTGGACCGTCTTGATGCTACAATCTTTAGGATCACTCCGTTGGTGACTCAAGTCGATAAGCTTAGCGAAGAAGTGGAAGATTCA---CCGAGGAAAGTCATCGAAGATCTTAAGCATCTCCTTGAAAAGGCTGTTTCTCTTGTTGAGGCTTATGCGGAACTCAGA---CGCAGAAACTTACTCAAGAAGTTCAGGTATAAGAGAAGGATCAAAGAGTTAGAAGCTTCATTAAGATGGATGGTAGATGTGGATGTCCAAGTCAATCAATGGGTAGATATCAAAGAACTTATGGCCAAGATGTCCGAAATGAACACTAAACTTGATGAAATCACTCGTCAACCA
TRN  10010101110011000
NAM  Q9SCS9_ARATH/2-148
ASQ  PLVEL---------LTSAALGLSLQLLHDAIIRAKERSLITRCILDRLDATLHKITPFVIKIDTLTEEVDEP-FRKVIEELKRLLEKAIRLVDAYAELK-LRNLLRKYRYKRRIKELDSSLRWMIDVDVQVNQWLDIKKLMGKMSEMNTKLDDITRQP
DSQ  CCTCTTGTTGAGCTT---------------------------CTTACAAGTGCTGCTCTTGGATTGTCCCTCCAACTCCTTCACGACGCCATCATAAGAGCCAAGGAGAGATCCTTAATCACAAGATGTATATTGGACCGTCTCGATGCTACACTCCATAAGATAACTCCATTTGTCATTAAGATCGATACCCTCACCGAAGAAGTCGATGAACCT---TTCAGAAAAGTCATCGAAGAGCTTAAACGTCTTCTCGAGAAAGCCATTCGTCTCGTTGATGCTTATGCGGAGCTTAAA---CTCCGAAACTTACTCAGGAAATATAGGTACAAGAGAAGAATCAAGGAGTTGGACTCTTCTTTGAGATGGATGATAGATGTGGATGTTCAAGTCAATCAATGGCTGGATATCAAAAAACTTATGGGTAAGATGTCTGAAATGAACACTAAACTCGATGATATTACGCGTCAACCA
TRN  10010101100011010
NAM  Q9C5Z6_ARATH/1-148
ASQ  MIAEV---------AAGGALGLALSVLHEAVKRAKDRSVTTRFILHRLEATIDSITPLVVQIDKFSEEMEDSTSRKVNKRLKLLLENAVSLVEENAELR-RRNVRKKFRYMRDIKEFEAKLRWVVDVDVQVNQLADIKELKAKMSEISTKLDKIMPQP
DSQ  ATGATTGCTGAGGTT---------------------------GCCGCAGGGGGTGCTCTTGGACTTGCTCTCAGTGTCCTCCACGAGGCCGTCAAAAGAGCAAAAGATAGATCTGTAACCACAAGATTCATCTTACACCGTCTCGAAGCTACAATCGATAGTATCACACCGTTGGTGGTTCAAATTGATAAGTTCAGTGAAGAAATGGAAGATTCAACATCGAGGAAAGTCAATAAACGTCTTAAGCTTCTCCTTGAGAACGCTGTTTCTCTTGTTGAGGAGAATGCGGAGCTGAGA---CGCAGAAACGTACGCAAGAAGTTCAGGTACATGAGAGATATCAAAGAGTTCGAAGCTAAATTACGATGGGTGGTAGATGTGGATGTTCAAGTTAATCAATTGGCTGATATCAAAGAACTCAAGGCCAAGATGTCTGAAATCAGCACTAAACTTGACAAAATAATGCCTCAACCG
TRN  10010101100011000
NAM  Q9C5Z7_ARATH/2-143
ASQ  PIGEL---------AIGAVLGVGAQAIYDRFRKARDISF-----VHRLCATILSIEPFLVQIDKRSKVEGSP-LREVNERLTCFLELAYVFVEAYPKLR-RRQVLRKYRYIKAIETIELALRSIIVVDFQVDQWDDIKEIKAKISEMDTKLAEVISAC
DSQ  CCGATTGGTGAGCTT---------------------------GCGATAGGGGCTGTTCTTGGAGTTGGAGCCCAAGCCATTTACGACCGGTTCAGAAAAGCAAGAGATATATCTTTC---------------GTACACCGTCTCTGCGCTACAATCCTTAGTATCGAGCCGTTTTTGGTTCAAATCGATAAGCGGAGTAAAGTGGAAGGTTCACCA---TTAAGGGAAGTCAACGAACGTCTCACGTGTTTCCTTGAATTAGCTTATGTTTTTGTTGAGGCTTATCCGAAACTCAGA---CGCAGACAAGTACTCAGGAAGTACAGGTACATCAAAGCAATCGAAACGATAGAACTTGCATTAAGAAGCATAATAGTTGTGGATTTTCAAGTTGATCAATGGGACGATATCAAAGAAATCAAGGCCAAGATATCTGAAATGGACACTAAACTTGCTGAAGTTATTTCTGCTTGT
TRN  10010101110011000
NAM  Q9SCS6_ARATH/2-152
ASQ  PIAELAVIKTVGGPLIAAALGVGAQVIYDGFRKGKDTS-----IINRLGRTMESISPVRDRIGKLSNVEGK-PFREVHESLTRLLEDAKSIIEKYWKLRWSRHVCRKYRYIKKLESIELELV-RVAREIQVHQWTDIKEMKAIQVHQWTDIKEMKAIQ
DSQ  CCGATTGCTGAGCTTGCTGTAATCAAAACAGTGGGTGGGCCTCTGATAGCGGCTGCTCTTGGAGTTGGAGCCCAAGTCATTTACGACGGCTTCAGAAAAGGAAAAGATACATCT---------------ATCATAAACCGTCTCGGCCGTACAATGGAAAGTATCAGTCCGGTGCGGGATCGAATCGGTAAGCTCAGTAATGTGGAAGGTAAA---CCATTTAGGGAAGTCCACGAAAGTCTTACGCGTCTCCTTGAAGATGCGAAATCTATTATTGAGAAATATTGGAAACTCAGATGGAGCAGACACGTTTGCAGGAAGTACAGGTACATCAAAAAACTCGAATCGATAGAACTTGAATTAGTA---AGGGTAGCACGTGAGATACAAGTCCACCAATGGACCGATATCAAAGAAATGAAGGCGATACAAGTCCACCAATGGACCGATATCAAAGAAATGAAGGCGATACAA
TRN  10010101100011010
//