EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05629 - Nanovirus_C8)
FAM  PF05629
PID  Nanovirus_C8
DES  Nanovirus component 8 (C8) protein
IPR  IPR008706
ANO  3
ALN  156
AID  0.541523
APH  (Q87011_9VIRU/1-153:0.23809,O91251_9VIRU/1-153:0.19535,Q65388_9VIRU/1-154:0.77531);
ATP  (Q87011_9VIRU/1-153,O91251_9VIRU/1-153,Q65388_9VIRU/1-154);
ATL  1.20875
DNO  3
DLN  468
DID  0.567262
DPH  (Q87011_9VIRU/1-153:0.18903,O91251_9VIRU/1-153:0.24017,Q65388_9VIRU/1-154:0.62640);
DTP  (Q87011_9VIRU/1-153,O91251_9VIRU/1-153,Q65388_9VIRU/1-154);
DTL  1.0556
RID  0.541523
RPH  (Q87011_9VIRU/1-153:0.23809,O91251_9VIRU/1-153:0.19535,Q65388_9VIRU/1-154:0.77531);
RTP  (Q87011_9VIRU/1-153,O91251_9VIRU/1-153,Q65388_9VIRU/1-154);
RTL  1.20875
LNK  O91251_9VIRU/1-153:O91251:AJ005965
LNK  Q65388_9VIRU/1-154:Q65388:L41577
LNK  Q87011_9VIRU/1-153:Q87011:U16733
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q87011_9VIRU/1-153
ASQ  MADWFHSALKTCTHVCDFSDIKASS---QQDFFCCDSMRGKLSEPRKVLLVSCFVSFTGSFYGSNRNVRGQVQLGMQQDDGVVRPIGYIPIGGYLYHDDYGYYQGEKTFNLDIESDYLKPDEDFWKRFTINIVNDKGLDDRCDVKCYVVHTMRIKV
DSQ  ATGGCGGACTGGTTTCACAGTGCGCTTAAGACATGTACTCATGTCTGTGATTTTTCAGATATTAAGGCGTCTTCA---------CAACAGGATTTCTTCTGTTGTGATAGTATGCGAGGTAAATTATCTGAACCTAGGAAGGTGTTGTTAGTTAGTTGTTTTGTAAGTTTTACTGGTAGTTTTTATGGAAGTAATAGGAATGTTAGAGGTCAAGTTCAGTTGGGTATGCAGCAAGATGATGGCGTTGTTCGTCCAATAGGATATATTCCTATTGGGGGTTATTTGTATCATGATGATTATGGATATTATCAAGGAGAGAAGACGTTCAATCTGGACATCGAGTCAGATTATCTGAAGCCTGATGAAGATTTTTGGAAGAGATTTACAATTAATATTGTAAATGATAAAGGATTAGATGATAGGTGTGATGTAAAATGTTATGTAGTTCATACGATGCGTATTAAGGTG
TRN  10010101100011000
NAM  O91251_9VIRU/1-153
ASQ  MADWFSSPLKTCTHVCDFPSLAGDP---QQEIMCCDSMKNKLQDSRKVLLVSCSVSFNGSFYGGNRNVRGQLQISMVEDDGVCRPIGYVPIGGYLYHNDYGYYEGTRTFNLDLESQYLKKDEDYNRKFLVSILNENGLDSQCDLKVFIVHSIRIKV
DSQ  ATGGCAGATTGGTTTTCCAGTCCTCTGAAAACATGTACTCATGTTTGTGATTTTCCTTCTCTTGCTGGTGACCCA---------CAGCAAGAGATTATGTGCTGTGATAGTATGAAGAATAAGTTGCAAGATTCAAGGAAGGTGTTACTTGTTAGTTGCAGTGTGAGCTTTAATGGTAGTTTCTATGGTGGTAACAGAAACGTTCGAGGTCAACTACAGATATCCATGGTTGAGGACGACGGTGTTTGTAGACCTATAGGTTATGTTCCTATTGGTGGATATCTGTATCATAACGACTATGGATATTACGAAGGTACAAGGACATTCAACCTGGATCTAGAGTCTCAGTATTTGAAGAAGGATGAAGATTATAATAGGAAGTTTTTAGTATCCATTCTTAATGAGAATGGTCTAGATAGTCAGTGTGATTTGAAAGTGTTTATTGTGCATTCGATTAGAATCAAAGTG
TRN  10010101100011000
NAM  Q65388_9VIRU/1-154
ASQ  M-DWAESQFKTCTHGCDWKKISSDSADNRQYVPCVDSGAGR-KSPRKVLLRSIEAVFNGSFSGNNRNVRGFLYVSIRDDDGEMRPVLIVPFGGYGYHNDFYYFEGKGKVECDISSDYVAPGIDWSRDMEVSISNSNNCNELCDLKCYVVCSLRIKE
DSQ  ATG---GATTGGGCGGAATCACAATTCAAGACCTGTACTCATGGATGCGATTGGAAGAAGATATCATCGGATTCAGCCGATAATCGACAATATGTACCATGCGTCGATTCTGGAGCTGGAAGA---AAGTCGCCTCGCAAGGTACTTCTTAGATCTATTGAAGCTGTGTTTAACGGAAGCTTCAGCGGAAATAATAGGAATGTTCGTGGATTTCTCTACGTATCGATCAGAGACGATGACGGAGAAATGCGTCCAGTACTCATAGTACCATTCGGAGGATATGGATATCATAATGATTTTTATTATTTCGAAGGGAAGGGGAAAGTTGAATGTGATATATCATCAGATTATGTTGCGCCAGGAATAGATTGGAGCAGAGACATGGAAGTTAGTATTAGTAACAGCAACAACTGTAATGAATTATGTGATCTGAAGTGTTATGTTGTTTGTTCGTTAAGAATCAAGGAA
TRN  10010101100011000
//