EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05617 - DUF784)
FAM  PF05617
PID  DUF784
DES  Arabidopsis thaliana protein of unknown function (DUF784)
IPR  IPR008502
ANO  4
ALN  141
AID  0.41192
APH  (Q9LKB8_ARATH/27-149:0.28227,Q8LFP2_ARATH/34-172:0.08409,(Q8LG63_ARATH/17-143:1.24278,Q9C924_ARATH/21-149:0.47487):0.43965);
ATP  (Q9LKB8_ARATH/27-149,Q8LFP2_ARATH/34-172,(Q8LG63_ARATH/17-143,Q9C924_ARATH/21-149));
ATL  2.52366
DNO  4
DLN  423
DID  0.556005
DPH  (Q9LKB8_ARATH/27-149:0.14286,Q8LFP2_ARATH/34-172:0.06795,(Q8LG63_ARATH/17-143:0.66745,Q9C924_ARATH/21-149:0.30716):0.30739);
DTP  (Q9LKB8_ARATH/27-149,Q8LFP2_ARATH/34-172,(Q8LG63_ARATH/17-143,Q9C924_ARATH/21-149));
DTL  1.49281
RID  0.41192
RPH  (Q9LKB8_ARATH/27-149:0.28227,Q8LFP2_ARATH/34-172:0.08409,(Q8LG63_ARATH/17-143:1.24278,Q9C924_ARATH/21-149:0.47487):0.43965);
RTP  (Q9LKB8_ARATH/27-149,Q8LFP2_ARATH/34-172,(Q8LG63_ARATH/17-143,Q9C924_ARATH/21-149));
RTL  2.52366
LNK  Q8LFP2_ARATH/34-172:Q8LFP2:AY084727
LNK  Q8LG63_ARATH/17-143:Q8LG63:AY084442
LNK  Q9C924_ARATH/21-149:Q9C924:AC019018
LNK  Q9LKB8_ARATH/27-149:Q9LKB8:AP000369
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9LKB8_ARATH/27-149
ASQ  VHEDVVISP------------TPFEKAISPAMEYEMKL-PHYSQKQYDFLEACVEKP--SSICGGEIFQNVLDETNLVTDKCCRNILKIGKDCHLGLMKILFSSYEYKNIAS--IPRSKQTWNDCLRRVGSKIGVPVSFE-
DSQ  GTACATGAAGATGTAGTCATATCTCCA------------------------------------ACTCCATTCGAAAAAGCTATTTCACCCGCAATGGAATATGAAATGAAGCTT---CCCCATTACTCGCAAAAACAGTATGATTTTCTAGAGGCTTGCGTTGAAAAGCCG------AGCTCCATATGCGGAGGTGAGATTTTCCAGAACGTGTTGGATGAAACAAACCTAGTGACAGATAAATGTTGTCGTAATATATTGAAGATTGGCAAAGATTGCCATCTTGGATTGATGAAAATCTTATTCTCATCGTATGAATATAAAAATATTGCATCT------ATTCCAAGAAGCAAACAGACATGGAACGATTGTCTTCGTAGAGTTGGAAGCAAGATTGGTGTTCCAGTCTCTTTTGAA---
TRN  10010101110011000
NAM  Q8LFP2_ARATH/34-172
ASQ  MPEDVTISPSSDFDYVEAPYEAPFEEADSPAMEYDMELAHHYSDKQFKFLEACSEKP--SSKCGNEVFKNMLNETMPITEECCRDILKMGKDCHLGLVKLIFATYEYKNIASKGIPKSKQTWNECVRRVGSKIGAPVSFEQ
DSQ  ATGCCAGAAGATGTGACCATATCTCCATCTTCAGATTTTGATTACGTCGAAGCTCCCTATGAAGCTCCATTCGAAGAAGCTGATTCACCAGCAATGGAATATGACATGGAGCTTGCTCACCATTATTCGGACAAACAGTTCAAGTTTCTTGAGGCTTGCTCTGAAAAGCCG------AGTTCAAAATGCGGAAATGAGGTTTTCAAGAACATGTTAAATGAGACGATGCCAATTACAGAAGAATGTTGTCGTGATATATTGAAGATGGGCAAAGATTGCCATCTAGGATTGGTTAAACTCATATTTGCCACATATGAGTATAAAAATATTGCATCTAAGGGCATTCCAAAGAGCAAACAAACATGGAACGAATGTGTCCGTAGAGTGGGGAGCAAGATTGGTGCTCCGGTCTCTTTTGAACAA
TRN  10010101110011000
NAM  Q9C924_ARATH/21-149
ASQ  IGQEEEISPISP---------ESLAYEPAAAYEYDHELLSHMTTRRIKFLQDCSDKM--SSKCNVEMTEGLIDDK-PVSEDCCVNFLKIGRECHEGLMTFVFATYELKDVASAILPRSKRMWNKCVETTAAKIGAPLAFET
DSQ  ATTGGTCAAGAAGAAGAGATCAGTCCAATATCTCCT---------------------------GAATCATTGGCATACGAACCCGCTGCAGCTTACGAGTACGACCACGAACTCCTAAGCCACATGACGACCCGGCGCATCAAATTTCTCCAAGATTGTTCGGATAAAATG------AGCTCGAAATGCAATGTTGAGATGACGGAAGGATTGATCGACGACAAG---CCCGTTTCGGAGGATTGTTGTGTGAACTTTTTGAAGATTGGAAGAGAATGTCACGAAGGATTGATGACTTTTGTGTTCGCCACTTATGAGCTAAAAGATGTTGCTTCTGCGATTCTTCCTAGGAGCAAACGGATGTGGAATAAATGTGTTGAGACCACTGCTGCTAAGATTGGTGCTCCTCTCGCTTTTGAAACT
TRN  10010101110011001
NAM  Q8LG63_ARATH/17-143
ASQ  NDKPLLISDDEF---------DAMMARSPTSDNYNENVGSKYSKKQINYLMNCSKKMAVPDKCIEEVMAEIIQNK-SASRYCCLGIVKAGKECHMEYMKLFFQMYELRRFTSKRFSKTNEIWNRC----STEIGVVSPYSG
DSQ  AATGACAAGCCACTCCTCATTTCAGACGACGAGTTT---------------------------GATGCTATGATGGCAAGATCTCCTACATCGGACAATTATAACGAAAATGTTGGTAGTAAATATTCAAAGAAACAAATAAATTATCTTATGAACTGCAGTAAAAAGATGGCCGTCCCAGATAAATGTATAGAAGAAGTGATGGCTGAAATTATTCAGAACAAA---AGTGCTTCAAGATATTGTTGTTTGGGGATAGTGAAAGCTGGAAAGGAATGTCACATGGAATATATGAAATTATTTTTTCAAATGTATGAACTCAGGCGTTTTACTTCTAAAAGGTTTTCCAAAACTAATGAGATATGGAACAGATGT------------TCCACCGAAATTGGAGTTGTTTCACCATATTCTGGT
TRN  10010101110011000
//