EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05582 - Peptidase_U57)
FAM  PF05582
PID  Peptidase_U57
DES  YabG peptidase U57
IPR  IPR008764
ANO  7
ALN  302
AID  0.497186
APH  ((((Q97F48_CLOAB/1-299:0.25781,(Q899A6_CLOTE/6-299:0.25419,Q8XIA4_CLOPE/1-293:0.38041):0.06710):0.29405,Q8R762_THETN/3-284:0.26837):0.57794,YABG_BACSU/3-290:0.28068):0.08735,Q8EU40_OCEIH/3-285:0.24473,Q9KGK3_BACHD/3-285:0.34147);
ATP  ((((Q97F48_CLOAB/1-299,(Q899A6_CLOTE/6-299,Q8XIA4_CLOPE/1-293)),Q8R762_THETN/3-284),YABG_BACSU/3-290),Q8EU40_OCEIH/3-285,Q9KGK3_BACHD/3-285);
ATL  3.04776
DNO  7
DLN  906
DID  0.547712
DPH  (Q97F48_CLOAB/1-299:0.20747,(Q8XIA4_CLOPE/1-293:0.26657,Q899A6_CLOTE/6-299:0.20718):0.05008,(Q8R762_THETN/3-284:0.29194,((YABG_BACSU/3-290:0.32621,Q8EU40_OCEIH/3-285:0.24769):0.07222,Q9KGK3_BACHD/3-285:0.26528):0.32082):0.18869);
DTP  (Q97F48_CLOAB/1-299,(Q8XIA4_CLOPE/1-293,Q899A6_CLOTE/6-299),(Q8R762_THETN/3-284,((YABG_BACSU/3-290,Q8EU40_OCEIH/3-285),Q9KGK3_BACHD/3-285)));
DTL  2.44415
RID  0.497186
RPH  ((((Q97F48_CLOAB/1-299:0.25781,(Q899A6_CLOTE/6-299:0.25419,Q8XIA4_CLOPE/1-293:0.38041):0.06710):0.29405,Q8R762_THETN/3-284:0.26837):0.57794,YABG_BACSU/3-290:0.28068):0.08735,Q8EU40_OCEIH/3-285:0.24473,Q9KGK3_BACHD/3-285:0.34147);
RTP  ((((Q97F48_CLOAB/1-299,(Q899A6_CLOTE/6-299,Q8XIA4_CLOPE/1-293)),Q8R762_THETN/3-284),YABG_BACSU/3-290),Q8EU40_OCEIH/3-285,Q9KGK3_BACHD/3-285);
RTL  3.04776
LNK  Q899A6_CLOTE/6-299:Q899A6:AE015936
LNK  Q8EU40_OCEIH/3-285:Q8EU40:BA000028
LNK  Q8R762_THETN/3-284:Q8R762:AE013197
LNK  Q8XIA4_CLOPE/1-293:Q8XIA4:BA000016
LNK  Q97F48_CLOAB/1-299:Q97F48:AE007788
LNK  Q9KGK3_BACHD/3-285:Q9KGK3:BA000004
LNK  YABG_BACSU/3-290:P37548:D26185
AMK  xxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9KGK3_BACHD/3-285
ASQ  PKVGDIVARKSYQCDLLFRIVALH-.---NDFVELIGEDMRLAADAPYHDLVLIQESERKRR--KKEFLQAEEQCYKLFRQDYN--------LMKQRDEYEASSGYTNDAAF----FEMRGRVLHMDGDPLYLRKCTEVYDRLGVPVYGVHVSEKEMPEQIASLIEMVQPDIIVVTGHDAYLKNRGTEKDLKAYRHTKFFAECVRIARRYVPQRDELVIFAGACQSHFETLIKAGANFASSPNRVNIHALDPVYIASRVSITSFMERVSLSEVLRNTITGEKGLGGIETKGVMRKGMPLKAM
DSQ  CCAAAGGTTGGGGATATCGTTGCGAGAAAATCGTATCAGTGTGATTTACTTTTTCGTATTGTAGCCCTCCAC---...---------AATGATTTTGTGGAGTTAATTGGTGAGGATATGCGCCTTGCGGCTGATGCTCCTTACCATGACCTTGTGTTGATTCAAGAATCCGAACGCAAGCGAAGG------AAAAAGGAGTTTTTACAAGCGGAGGAGCAGTGTTATAAGCTTTTTAGACAGGATTACAAT------------------------TTGATGAAGCAACGGGATGAATATGAAGCCTCCTCAGGTTATACGAACGATGCAGCGTTT------------TTTGAAATGCGAGGTAGGGTGCTTCATATGGATGGTGACCCTCTGTATTTACGCAAGTGTACGGAAGTGTATGATCGATTGGGCGTGCCCGTGTATGGAGTCCACGTTTCAGAAAAAGAGATGCCGGAACAGATCGCCTCTCTTATTGAAATGGTACAGCCGGATATTATTGTTGTGACAGGACATGATGCGTATTTAAAAAACCGTGGGACGGAAAAGGACCTTAAAGCTTATCGGCATACAAAATTTTTTGCGGAATGTGTAAGGATTGCGAGACGCTATGTGCCTCAGCGGGATGAACTTGTGATTTTTGCAGGGGCTTGCCAATCCCATTTTGAAACACTGATCAAAGCAGGAGCTAATTTTGCAAGCTCACCCAATCGAGTGAATATTCATGCTCTAGACCCGGTGTATATAGCTTCCCGTGTTAGTATTACATCGTTTATGGAACGTGTTTCCTTATCAGAAGTACTCCGAAATACGATTACAGGGGAAAAAGGTCTAGGAGGGATCGAGACGAAGGGTGTCATGCGAAAAGGGATGCCTTTAAAAGCTATG
TRN  10010101100011000
NAM  Q8EU40_OCEIH/3-285
ASQ  IANGELVTRKSYDHDLLFRVIEIK-.---KDIAVLHGEDMRLAADAPLNDLSKVDQREKKRR--KEQEKEKQETSYRLFRQDYQ--------LMKEKRNYEATEGYSNAASY----FQLPAKVLHMDGDANYLRKCIQLYQRIGLQVHGVHLTEVQMPEEINDLLERIQPDILVITGHDAYSKNKGLKNDLRAYRHSKYFVETVREARRVVPNLDQLIIFAGACQSHFESIIRAGANFASSPSRVNIHALDPVYIVAKIAYTPFMESVSVWEALRNTLTGERGLGGIETKGLLRTGMPFVED
DSQ  ATTGCAAACGGAGAGCTTGTAACACGAAAGTCATATGATCATGATTTATTATTTCGTGTAATAGAGATTAAA---...---------AAAGATATTGCTGTTTTACATGGGGAGGATATGCGATTAGCTGCAGATGCCCCCCTGAATGATTTATCAAAAGTTGATCAGCGAGAGAAAAAAAGAAGA------AAAGAACAGGAGAAAGAAAAGCAAGAAACATCGTATAGATTATTTAGGCAAGACTATCAG------------------------TTAATGAAGGAAAAGCGGAATTACGAGGCAACCGAAGGATATTCGAATGCAGCAAGTTAC------------TTTCAACTACCTGCGAAAGTATTGCATATGGATGGGGACGCAAACTATTTACGAAAATGTATACAATTGTATCAACGAATCGGATTACAAGTCCATGGGGTGCATTTAACAGAAGTTCAAATGCCAGAAGAAATTAATGATCTATTAGAACGTATTCAACCAGATATACTGGTTATTACAGGTCATGATGCATATTCGAAAAACAAGGGATTAAAGAATGATTTGCGTGCATATCGGCATTCAAAGTATTTCGTGGAAACAGTAAGAGAAGCAAGAAGAGTGGTTCCTAATCTTGATCAGTTAATTATATTTGCGGGTGCGTGTCAGTCACATTTTGAATCCATTATTCGCGCAGGGGCCAATTTTGCTAGCTCCCCTTCAAGAGTAAATATTCATGCCCTAGATCCTGTTTATATCGTTGCTAAAATAGCATATACACCTTTTATGGAGAGTGTTTCGGTTTGGGAAGCACTTAGAAATACATTAACCGGAGAAAGAGGGTTAGGTGGTATCGAAACGAAAGGGTTATTGCGAACAGGTATGCCTTTTGTAGAGGAT
TRN  10010101100011000
NAM  YABG_BACSU/3-290
ASQ  FQIGDMVARKSYQMDVLFRIIGIEQtSKGNSIAILHGDEVRLIADSDFSDLVAVKKDEQMMR--KKKDESRMNESLELLRQDYK--------LLREKQEYYATSQYQHQEHY----FHMPGKVLHLDGDEAYLKKCLNVYKKIGVPVYGIHCHEKKMSASIEVLLDKYRPDILVITGHDAYSKQKGGIDDLNAYRHSKHFVETVQTARKKIPHLDQLVIFAGACQSHFESLIRAGANFASSPSRVNIHALDPVYIVAKISFTPFMERINVWEVLRNTLTREKGLGGIETRGVLRIGMPYKSN
DSQ  TTTCAAATAGGGGATATGGTAGCCAGAAAATCCTATCAGATGGATGTTTTGTTTCGAATTATAGGAATAGAGCAAacaAGCAAAGGAAATTCAATTGCCATTTTGCATGGAGATGAAGTCAGGCTGATTGCTGATTCGGATTTTTCTGATCTGGTGGCAGTGAAAAAGGATGAGCAGATGATGCGG------AAAAAGAAAGATGAGAGCAGAATGAATGAGTCGCTCGAATTGCTCCGCCAAGATTATAAG------------------------CTGCTCAGAGAAAAGCAGGAGTACTATGCGACAAGCCAATATCAGCATCAGGAGCATTAT------------TTCCATATGCCGGGCAAAGTGCTTCATCTGGATGGTGACGAAGCATATTTGAAAAAATGCCTGAATGTCTATAAAAAAATTGGAGTGCCGGTCTATGGCATCCATTGCCATGAAAAGAAAATGTCTGCTTCTATTGAAGTATTGCTCGACAAATATCGACCTGACATCCTGGTGATCACAGGGCATGATGCGTACTCGAAGCAAAAGGGCGGTATTGATGATTTGAATGCGTACAGACATTCTAAGCACTTTGTTGAAACAGTTCAAACAGCCCGAAAAAAGATCCCTCACTTAGATCAGCTTGTTATTTTTGCGGGGGCCTGCCAATCCCATTTTGAATCACTCATCAGAGCGGGTGCGAATTTTGCAAGTTCACCGTCAAGAGTCAATATTCATGCGCTTGATCCGGTATATATCGTCGCGAAGATCAGCTTTACGCCGTTTATGGAACGGATTAATGTATGGGAAGTGCTCCGTAATACGCTGACAAGAGAGAAAGGGCTTGGAGGTATTGAAACAAGAGGAGTTCTGAGAATTGGTATGCCTTATAAGTCCAAT
TRN  10010101100011000
NAM  Q97F48_CLOAB/1-299
ASQ  MVIGDFVVRKSYGEDITFKIIDIIN.DKGVNYCVLKGVNLRIIADSPEDDLRLVQASNEGKV--DSVFNETINKSIRDIITERSNSIKIGKNILQKTYKKKKMRTSNSSEGINNMTFARPGKVLHIDGDSEYLEVCLKVYKQLSIDAVGKVILEKEQPEKVVDIVKVVKPDIVVVTGHDGMVKNTRNYMDINNYRNSSYFIKSVSNLRDYEPSYDDLVIFAGACQSCYEGILDAGANYASSPGRVLIHCLDPVFVCEKVAYTNVGDIVNIKEVVKGTVTGVKGIGGLQTRGKCREGYPKSSY
DSQ  TTGGTTATCGGAGATTTTGTTGTGAGAAAATCCTATGGAGAGGATATAACATTTAAGATTATAGACATAATAAAT...GATAAGGGAGTAAATTATTGTGTCCTAAAAGGAGTTAATCTTAGAATAATAGCTGATTCCCCTGAAGATGATTTAAGGCTTGTTCAGGCAAGTAATGAAGGAAAGGTC------GATAGTGTATTCAATGAAACAATAAATAAGTCCATAAGAGATATAATAACAGAAAGATCAAATTCAATTAAAATAGGTAAAAATATTTTACAAAAAACATATAAGAAAAAAAAAATGAGAACGTCAAATAGCAGTGAAGGAATTAATAATATGACATTTGCAAGACCTGGGAAAGTACTGCATATAGATGGAGATTCTGAGTATTTAGAGGTATGTCTAAAAGTATATAAACAGCTATCCATAGATGCGGTAGGTAAGGTTATATTAGAAAAGGAGCAGCCGGAAAAAGTAGTAGATATAGTTAAGGTAGTTAAACCTGATATAGTAGTAGTAACAGGACATGATGGTATGGTTAAAAATACTCGTAATTATATGGATATAAATAATTACAGGAATTCATCATATTTTATCAAATCGGTTTCAAATTTAAGAGATTATGAACCAAGTTATGATGATCTTGTTATTTTTGCAGGTGCATGTCAATCCTGCTATGAGGGAATTTTAGATGCAGGTGCAAATTATGCTAGTTCTCCTGGGAGAGTTTTAATTCACTGTTTGGATCCTGTTTTTGTATGTGAAAAGGTAGCTTATACAAATGTTGGAGATATAGTGAATATAAAAGAGGTAGTTAAAGGTACGGTAACTGGAGTAAAAGGTATAGGGGGACTTCAAACAAGAGGTAAGTGCAGAGAAGGGTATCCTAAATCATCATAT
TRN  10010101100011000
NAM  Q899A6_CLOTE/6-299
ASQ  MNIGDIVARKSYGKDITFKIIDIQK.SKKGKLYKLKGVNLRIIADSLGNDLELVKEENTKYE---KVFDERINTSIKNILMNRGEEISTSKY-TRSSDKEIRVTRGKKNNGL---AFGRPGKILHVDGDAEYLDVCMKVYKQLELDVVGAIIAEKEQPEKVLQMVKEVKPDIVIITGHDAILKNTTNYMDLNNYRNSKYFIRTVNELRNYEPGYDNLVIFAGACQSYYEAILDAGANFASAPNRVLIHCLDPVFLCEKIAYSNIGKVVSIQEALENTITGANGIGGLQTRGKYREGFPKSLY
DSQ  ATGAATATAGGGGACATAGTTGCAAGAAAATCTTATGGTAAAGATATAACTTTTAAAATAATAGATATACAGAAG...AGTAAAAAAGGAAAACTATATAAACTAAAAGGCGTAAATCTAAGAATTATAGCAGACTCATTAGGAAATGATTTAGAACTAGTTAAAGAAGAGAATACTAAGTATGAA---------AAAGTATTTGACGAAAGAATAAATACTTCAATAAAAAATATTCTGATGAATAGAGGTGAAGAAATTAGTACCTCAAAATAT---ACCAGATCCTCGGATAAGGAAATAAGGGTTACAAGGGGAAAAAAAAATAATGGATTA---------GCTTTTGGAAGGCCAGGTAAGATATTGCACGTGGACGGAGATGCAGAGTATTTAGATGTATGTATGAAAGTATATAAGCAGTTAGAACTAGATGTAGTTGGGGCTATTATAGCTGAAAAGGAACAACCTGAGAAAGTTTTGCAGATGGTAAAGGAAGTTAAGCCCGATATTGTTATAATAACAGGCCACGATGCAATATTAAAAAATACAACAAATTATATGGACTTAAATAACTATAGGAATTCTAAGTACTTTATAAGAACTGTAAATGAACTTAGAAATTATGAACCAGGATATGATAACTTAGTTATATTTGCTGGTGCATGTCAATCTTATTATGAGGCCATATTAGACGCAGGTGCTAATTTTGCTAGTGCACCTAATAGAGTGCTTATACATTGCTTGGACCCAGTGTTCCTATGTGAGAAAATAGCATATAGCAATATAGGAAAAGTTGTATCCATTCAAGAGGCATTAGAAAATACAATAACAGGAGCCAATGGAATAGGGGGACTTCAAACAAGAGGTAAATATAGAGAAGGGTTTCCAAAATCATTGTAT
TRN  10010101100011000
NAM  Q8XIA4_CLOPE/1-293
ASQ  MKVGDLVVRKSYSKDITFKIIDIKE.NEEGITYILKGLHIRIIADSKREDLEKVEDDFAGDK--DKSFDSKMNDIIKKVILSRE---QKNNQLMTRGSEEDNLKRTEKEKGL---VFGRPGRILHIDGDPSYMETCLKAYKQLNLNAVGIAVSEREQPLKILSLVKEYNPDIVVLTGHDGVLKDSKGMLDLNNYRNSKYFIESVKILRNYNSSYDELVIFAGACQSCYESILEAGANFASSPNRVLIHCLDPVLVCERVAYTRIDEIVSIKDVIENTITGIKGVGGLQTRGKYREGYPKSLY
DSQ  ATGAAAGTTGGAGATTTAGTAGTAAGAAAATCATATAGTAAGGATATAACTTTTAAAATTATAGATATTAAAGAA...AATGAGGAAGGAATAACTTATATTTTAAAGGGGCTTCATATAAGGATAATAGCTGACTCTAAGAGAGAGGATTTAGAAAAAGTTGAGGATGACTTTGCTGGAGATAAA------GATAAATCCTTTGATTCTAAAATGAATGATATCATTAAAAAAGTAATTTTGAGTAGAGAA---------CAGAAAAATAATCAATTAATGACAAGAGGAAGTGAAGAGGATAATTTAAAAAGGACAGAAAAAGAAAAAGGGTTA---------GTATTTGGAAGACCTGGACGAATACTTCATATAGATGGAGATCCATCATATATGGAAACCTGCTTAAAGGCGTACAAGCAATTAAACTTAAATGCTGTAGGAATAGCAGTATCCGAAAGAGAACAACCTTTAAAAATTTTATCTTTAGTTAAGGAATATAATCCAGATATAGTTGTATTAACTGGCCATGATGGGGTTCTTAAAGATTCTAAGGGAATGCTTGATTTAAATAATTATAGAAACTCAAAGTATTTTATTGAATCTGTAAAAATTTTAAGAAATTATAATTCAAGTTATGATGAGCTTGTTATTTTTGCTGGTGCTTGTCAATCTTGTTATGAAAGTATTTTAGAAGCAGGTGCTAATTTTGCAAGTTCACCTAATAGGGTACTTATACATTGTTTAGATCCAGTTTTAGTATGTGAAAGAGTTGCATATACAAGAATAGATGAAATTGTTTCAATAAAAGATGTTATAGAAAATACAATAACTGGAATAAAAGGAGTGGGTGGATTACAAACTAGAGGAAAATATAGAGAAGGTTATCCAAAATCCTTATAT
TRN  10010101110011000
NAM  Q8R762_THETN/3-284
ASQ  FRINDIVMRKSYGSDILFRVINVID.NKGVRYYLLHGLNMRIIADAPEDDL--IEASRAKIVEYDRPYREKAEYLLKKIAQSKS------------LQRKKGMARGVRQEPY-----GRPGKVLHIDGDEEYLNICMEAYRKVGMEVVGVVLKEEEQPEKVYDLLERYRPDILVITGHDSIKSSARDYGDLESYRNSKYFVEAVKNARKYEPSLDNLVIFAGACQSNYEALIKAGANYASSPERVLIHCLDPVLVSEKVAFSHINELVKIEDLIEHTITGAAGIGGLQTMGKFRYGVPKGKY
DSQ  TTTCGCATAAATGACATTGTGATGAGGAAGTCCTATGGCTCTGACATTTTGTTCAGAGTCATTAATGTCATAGAT...AACAAAGGAGTAAGATATTACCTTCTGCACGGGCTTAACATGAGGATAATAGCAGATGCACCTGAAGATGACCTG------ATTGAAGCCTCCCGAGCTAAAATCGTGGAATACGATAGGCCTTATAGGGAAAAGGCAGAGTATCTTTTAAAAAAAATTGCTCAGTCAAAAAGC------------------------------------CTTCAGCGAAAGAAAGGCATGGCAAGAGGAGTGCGCCAGGAACCCTAC---------------GGAAGGCCAGGAAAGGTCCTTCACATCGACGGAGATGAAGAGTATTTAAATATATGCATGGAGGCTTACAGGAAAGTAGGCATGGAAGTGGTGGGGGTAGTTTTAAAAGAAGAGGAACAGCCGGAAAAGGTCTATGACCTTTTGGAAAGGTACAGGCCAGATATTTTAGTTATTACCGGCCATGACAGCATAAAAAGCAGTGCCAGAGATTACGGGGACTTGGAGAGCTATAGGAATTCAAAATATTTTGTTGAGGCAGTTAAAAATGCCAGAAAATATGAGCCTTCTCTTGATAACCTGGTAATTTTTGCTGGAGCTTGTCAGTCCAATTATGAGGCTTTGATAAAGGCAGGAGCGAATTACGCCAGTTCACCAGAAAGGGTGCTAATCCACTGTTTGGATCCGGTACTTGTTAGTGAAAAAGTGGCTTTTTCCCATATAAATGAACTCGTAAAAATAGAGGACTTGATAGAGCACACTATCACTGGTGCGGCTGGAATTGGAGGCCTGCAGACGATGGGAAAGTTCAGATATGGTGTGCCTAAAGGAAAGTAT
TRN  10010101100011000
//