EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05578 - Peptidase_S31)
FAM  PF05578
PID  Peptidase_S31
DES  Pestivirus NS3 polyprotein peptidase S31
IPR  IPR000280
ANO  4
ALN  211
AID  0.874541
APH  (Q04232_BVDV/149-359:0.02614,(Q68287_9FLAV/2-212:0.06028,O09461_9FLAV/1588-1798:0.05345):0.02853,O11993_BVDV/1590-1800:0.10642);
ATP  (Q04232_BVDV/149-359,(Q68287_9FLAV/2-212,O09461_9FLAV/1588-1798),O11993_BVDV/1590-1800);
ATL  0.27482
DNO  4
DLN  633
DID  0.759084
DPH  (Q04232_BVDV/149-359:4.14068,(Q68287_9FLAV/2-212:17.11582,O09461_9FLAV/1588-1798:14.18012):10.82437,O11993_BVDV/1590-1800:8.33130);
DTP  (Q04232_BVDV/149-359,(Q68287_9FLAV/2-212,O09461_9FLAV/1588-1798),O11993_BVDV/1590-1800);
DTL  54.602
RID  0.874541
RPH  (Q04232_BVDV/149-359:0.02614,(Q68287_9FLAV/2-212:0.06028,O09461_9FLAV/1588-1798:0.05345):0.02853,O11993_BVDV/1590-1800:0.10642);
RTP  (Q04232_BVDV/149-359,(Q68287_9FLAV/2-212,O09461_9FLAV/1588-1798),O11993_BVDV/1590-1800);
RTL  0.27482
LNK  O09461_9FLAV/1588-1798:O09461:AF002227
LNK  O11993_BVDV/1590-1800:O11993:U86599
LNK  Q04232_BVDV/149-359:Q04232:M62431
LNK  Q68287_9FLAV/2-212:Q68287:U21328
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q04232_BVDV/149-359
ASQ  GPAVCKKITEHERCHVNILDKLTAFLGIMPRGTTPRPPVRFPTSLLKVRRGLETGWAYTHQGGISSVDHVTAGKDLLVCDSMGRTRVVCQSNNKLTDETEYGVKTDSGCPDGARCYVLNPEAVNISGSKGAVVHLQKTGREFTCVTASGTPAFFDLKNLKGWSGLPIFEASSGRVVGRVKVGKNEESKPTKIMSGIQTVSKNTADLTEMVK
DSQ  GGGCCTGCCGTGTGTAAGAAGATCACAGAACACGAAAGATGCCATGTCAACATATTAGATAAACTAACTGCATTTCTTGGGATCATGCCAAGAGGGACCACACCCAGACCCCCAGTGAGGTTTCCTACGAGTTTGTTAAAAGTGAGGAGGGGTCTGGAGACTGGTTGGGCTTATACACACCAAGGTGGGATAAGTTCAGTAGACCATGTAACCGCTGGCAAAGATCTATTGGTCTGTGACAGTATGGGAAGAACTAGAGTGGTCTGCCAGAGCAACAATAAGTTAACTGATGAGACAGAGTATGGTGTCAAGACTGACTCAGGATGCCCAGATGGTGCCAGATGTTACGTGCTAAATCCAGAGGCAGTCAACATATCGGGTTCTAAAGGGGCAGTCGTCCACCTCCAAAAGACAGGACGGGAATTCACGTGTGTCACCGCATCAGGCACACCGGCTTTCTTTGATCTAAAAAACTTGAAGGGATGGTCGGGCCTACCTATTTTTGAAGCCTCCAGCGGAAGGGTGGTTGGTAGAGTTAAGGTGGGGAAGAATGAAGAGTCCAAACCCACGAAGATAATGAGTGGCATCCAGACCGTCTCAAAGAATACAGCAGATCTGACTGAGATGGTCAAG
TRN  10010101100011000
NAM  O09461_9FLAV/1588-1798
ASQ  GPAVCKKITNHEKCHVNIMDKLTAFFGIIARGTTPRAPVRFPTALLKVRRGLETGWAYTHQGGISSVDHVTAGKDLLVCDSMGRTRVVCHSNNKMTDETEYGIKTDSGCPEGARCYVLNPEAVNISGTKGAMVHLQKTGGEFTCVTASGTPAFFDLKNLKGWSGLPIFEASSGRVVGRVKVGKNEDSKPTKLMSGIQTVSKNQTDLADIVK
DSQ  GGGCCAGCCGTGTGCAAGAAAATTACCAACCATGAGAAGTGCCACGTAAACATCATGGATAAGCTAACTGCATTCTTTGGAATCATCGCTAGAGGCACAACCCCTAGGGCACCTGTGAGGTTCCCCACAGCACTACTGAAAGTGAGAAGGGGGCTAGAGACGGGATGGGCTTACACACACCAAGGAGGGATCAGCTCGGTAGACCATGTCACAGCCGGAAAGGATCTACTAGTGTGTGACAGCATGGGCAGGACCAGGGTTGTCTGTCATAGTAACAATAAGATGACTGATGAGACTGAGTATGGCATCAAGACCGACTCAGGGTGTCCCGAAGGTGCGAGGTGTTACGTGCTAAACCCAGAAGCTGTTAACATTTCTGGCACAAAAGGAGCTATGGTACATCTCCAGAAAACGGGGGGGGAGTTCACATGTGTCACTGCCTCAGGGACCCCGGCTTTCTTCGATCTGAAAAATCTAAAAGGCTGGTCCGGGCTACCAATTTTTGAAGCATCCAGTGGCAGGGTGGTTGGTAGGGTGAAAGTCGGCAAGAATGAGGATTCCAAGCCCACCAAATTAATGAGTGGAATCCAGACAGTGTCTAAGAACCAGACGGACCTAGCGGACATTGTAAAA
TRN  10010101100011000
NAM  Q68287_9FLAV/2-212
ASQ  GPAVCKKVTEHEKCTTSIMDKLTAFFGVMPRGTTPRAPVRFPTSLLKIRGGLETGWAYTHQGGISSVDHVTCGKDLLVCDTMGRTRVVCQSNNKMTDESEYGVKTDSGCPEGARCYVFNPEAVNISGTKGAMVHLQKTGGEFTCVTASGTPAFFDLKNLKGWSGLPIFEASSGRVVGRVKVGKNEDSKPTKLMSGIQTVSKSTADLTEMVK
DSQ  GGACCTGCAGTTTGCAAGAAAGTTACCGAACATGAGAAATGCACCACATCCATAATGGACAAATTGACTGCTTTTTTCGGTGTTATGCCAAGGGGCACCACACCTAGAGCCCCTGTGAGATTCCCCACCTCTCTCTTAAAGATAAGAGGGGGGTTAGAAACTGGCTGGGCGTACACACACCAAGGTGGCATTAGTTCAGTGGACCATGTCACTTGTGGGAAAGACTTACTGGTATGTGACACTATGGGCCGGACAAGGGTCGTTTGCCAATCAAATAATAAGATGACAGACGAGTCCGAGTATGGAGTTAAAACTGACTCCGGATGCCCAGAGGGAGCTAGGTGTTACGTGTTCAACCCAGAGGCAGTTAACATATCGGGGACTAAAGGAGCCATGGTTCACTTACAAAAAACTGGAGGAGAATTCACCTGTGTGACAGCATCAGGGACTCCGGCCTTCTTTGATCTCAAGAACCTCAAAGGCTGGTCAGGGCTACCGATATTTGAGGCATCAAGTGGAAGGGTAGTCGGCAGGGTCAAGGTCGGGAAGAATGAGGACTCTAAACCAACCAAGCTTATGAGCGGAATACAAACAGTCTCAAAAAGTACCGCAGACTTGACAGAAATGGTAAAG
TRN  10010101100011000
NAM  O11993_BVDV/1590-1800
ASQ  GPAVCKKITGHEKCHVNILDKLTAFFGVMPRGTTPRAPVRFPTALLKVRRELETGLGLTHQGGISSVDHVTTGKDRLVCDSMGRTRVVCQSNNKLTDETEYGVKTDSGCPDGARCYVLNPEALNISGSKGAVVHLQKTGGEFTCVTASGTPAFFDSKNLKGGSNPPIFEASSGRMVGRGKVGKNEESKPTKLTSGIQSRGKNKADLTEMVK
DSQ  GGACCTGCCGTGTGCAAGAAAATAACTGGGCACGAAAAATGCCATGTTAACATACTGGACAAGCTGACTGCGTTTTTCGGGGTTATGCCAAGAGGAACCACACCCAGGGCTCCGGTGAGGTTCCCGACAGCATTACTAAAGGTAAGGAGGGAATTGGAAACCGGTTTGGGGCTTACACACCAAGGCGGCATAAGCTCAGTAGACCATGTTACCACTGGCAAGGACCGATTGGTTTGCGACAGTATGGGTAGAACTAGAGTGGTTTGCCAAAGCAACAACAAGTTAACTGATGAGACAGAGTATGGTGTCAAGACCGACTCAGGATGCCCAGATGGTGCCAGATGTTATGTGCTGAATCCAGAAGCACTCAACATATCAGGATCCAAAGGGGCAGTTGTCCACCTCCAAAAGACTGGTGGGGAATTCACGTGTGTCACTGCATCAGGTACCCCGGCTTTCTTTGACTCAAAAAACTTGAAAGGGGGGTCAAACCCGCCCATATTTGAAGCCTCCAGCGGAAGGATGGTTGGCAGAGGTAAAGTAGGGAAGAATGAAGAATCCAAACCCACAAAGCTAACCAGTGGCATCCAGAGCCGTGGAAAAAACAAAGCAGATCTAACTGAGATGGTCAAG
TRN  10010101100011000
//