EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05569 - Peptidase_M56)
FAM  PF05569
PID  Peptidase_M56
DES  BlaR1 peptidase M56
IPR  IPR008756
ANO  12
ALN  97
AID  0.347343
APH  (((((((((Q9A7T1_CAUCR/152-247:0.31843,Q9A2P8_CAUCR/140-235:0.25160):0.14229,(Q8P5X8_XANCP/136-231:0.08609,Q8PH97_XANAC/133-228:0.23167):0.26723):0.08853,Q8PED5_XANCP/181-276:0.96923):0.12615,Q9A4S6_CAUCR/151-246:0.48854):0.32616,Q8RPJ4_DESHA/160-252:0.53901):0.62771,Q8RAW0_THETN/183-278:0.27456):0.10007,Q97DN5_CLOAB/180-276:0.39695):0.38135,Q53709_STAAU/173-269:0.51109):0.13995,Q9K4N2_STAHA/170-266:0.75293,Q8YAA1_LISMO/171-264:0.64791);
ATP  (((((((((Q9A7T1_CAUCR/152-247,Q9A2P8_CAUCR/140-235),(Q8P5X8_XANCP/136-231,Q8PH97_XANAC/133-228)),Q8PED5_XANCP/181-276),Q9A4S6_CAUCR/151-246),Q8RPJ4_DESHA/160-252),Q8RAW0_THETN/183-278),Q97DN5_CLOAB/180-276),Q53709_STAAU/173-269),Q9K4N2_STAHA/170-266,Q8YAA1_LISMO/171-264);
ATL  7.6893
DNO  12
DLN  291
DID  0.458619
DPH  ((((((Q8PED5_XANCP/181-276:0.42709,((Q8P5X8_XANCP/136-231:0.07636,Q8PH97_XANAC/133-228:0.21009):0.12098,((Q9A7T1_CAUCR/152-247:0.18636,Q9A2P8_CAUCR/140-235:0.19549):0.08897,Q9A4S6_CAUCR/151-246:0.25180):0.08023):0.07683):0.35052,Q8RPJ4_DESHA/160-252:0.27987):0.51761,Q8YAA1_LISMO/171-264:0.35344):0.14485,Q97DN5_CLOAB/180-276:0.23233):0.09128,Q8RAW0_THETN/183-278:0.31166):0.14845,Q9K4N2_STAHA/170-266:0.43339,Q53709_STAAU/173-269:0.32447);
DTP  ((((((Q8PED5_XANCP/181-276,((Q8P5X8_XANCP/136-231,Q8PH97_XANAC/133-228),((Q9A7T1_CAUCR/152-247,Q9A2P8_CAUCR/140-235),Q9A4S6_CAUCR/151-246))),Q8RPJ4_DESHA/160-252),Q8YAA1_LISMO/171-264),Q97DN5_CLOAB/180-276),Q8RAW0_THETN/183-278),Q9K4N2_STAHA/170-266,Q53709_STAAU/173-269);
DTL  4.90207
RID  0.347343
RPH  (((((((((Q9A7T1_CAUCR/152-247:0.31843,Q9A2P8_CAUCR/140-235:0.25160):0.14229,(Q8P5X8_XANCP/136-231:0.08609,Q8PH97_XANAC/133-228:0.23167):0.26723):0.08853,Q8PED5_XANCP/181-276:0.96923):0.12615,Q9A4S6_CAUCR/151-246:0.48854):0.32616,Q8RPJ4_DESHA/160-252:0.53901):0.62771,Q8RAW0_THETN/183-278:0.27456):0.10007,Q97DN5_CLOAB/180-276:0.39695):0.38135,Q53709_STAAU/173-269:0.51109):0.13995,Q9K4N2_STAHA/170-266:0.75293,Q8YAA1_LISMO/171-264:0.64791);
RTP  (((((((((Q9A7T1_CAUCR/152-247,Q9A2P8_CAUCR/140-235),(Q8P5X8_XANCP/136-231,Q8PH97_XANAC/133-228)),Q8PED5_XANCP/181-276),Q9A4S6_CAUCR/151-246),Q8RPJ4_DESHA/160-252),Q8RAW0_THETN/183-278),Q97DN5_CLOAB/180-276),Q53709_STAAU/173-269),Q9K4N2_STAHA/170-266,Q8YAA1_LISMO/171-264);
RTL  7.6893
LNK  Q53709_STAAU/173-269:Q53709:L14017
LNK  Q8P5X8_XANCP/136-231:Q8P5X8:AE012437
LNK  Q8PED5_XANCP/181-276:Q8PED5:AE012098
LNK  Q8PH97_XANAC/133-228:Q8PH97:AE011982
LNK  Q8RAW0_THETN/183-278:Q8RAW0:AE013071
LNK  Q8RPJ4_DESHA/160-252:Q8RPJ4:AF403182
LNK  Q8YAA1_LISMO/171-264:Q8YAA1:AL591974
LNK  Q97DN5_CLOAB/180-276:Q97DN5:AE007841
LNK  Q9A2P8_CAUCR/140-235:Q9A2P8:AE006009
LNK  Q9A4S6_CAUCR/151-246:Q9A4S6:AE005941
LNK  Q9A7T1_CAUCR/152-247:Q9A7T1:AE005839
LNK  Q9K4N2_STAHA/170-266:Q9K4N2:AJ400722
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q97DN5_CLOAB/180-276
ASQ  PCITGLIKPCILIPDYIAYKLTKEEIKYVIIHELSHFKHKDIIINWISIVLNVIHWFNPILYFFFRKFKQDSEIACDAKALSYIKSRERKEYGKTII
DSQ  CCATGCATAACTGGTCTTATTAAGCCATGTATACTCATACCAGATTACATTGCTTATAAATTAACAAAAGAAGAAATAAAATATGTAATTATTCATGAACTTTCACATTTTAAGCATAAGGACATTATTATAAATTGGATAAGCATAGTATTGAATGTTATCCATTGGTTTAATCCAATATTGTACTTTTTCTTTAGAAAGTTCAAACAAGATTCTGAAATAGCTTGCGATGCTAAAGCATTAAGCTATATAAAAAGTAGAGAACGTAAAGAATATGGTAAAACAATTATT
TRN  10010101110011000
NAM  Q8RAW0_THETN/183-278
ASQ  PAIFGIFKPYILISPEILK-LNEEEISYIFIHELAHLKRKDLLVNYLLLVLQILHWFNPFIWYFFKKIRQDMEVAADWKVLDILENNERKKYGRTLI
DSQ  CCCGCCATTTTTGGAATTTTTAAGCCGTACATATTGATATCACCAGAAATTTTAAAG---CTGAATGAAGAAGAAATATCGTATATTTTCATTCATGAACTTGCCCACTTGAAGAGAAAAGACCTTCTTGTAAATTATCTGTTACTGGTACTGCAAATACTGCATTGGTTCAATCCTTTTATATGGTATTTTTTTAAAAAAATTCGTCAGGACATGGAGGTAGCAGCCGATTGGAAAGTACTTGATATTTTGGAGAATAATGAACGAAAGAAATACGGGAGAACTCTAATA
TRN  10010101100011000
NAM  Q53709_STAAU/173-269
ASQ  PMVFGLVKSQIVLPTVVVETMNDKEIEYIILHELSHVKSHDLIFNQLYVVFKMIFWFNPALYISKTMMDNDCEKVCDRNVLKILNRHEHIRYGESIL
DSQ  CCGATGGTATTTGGTTTAGTGAAATCCCAAATTGTACTACCAACTGTCGTAGTCGAAACCATGAATGACAAAGAAATTGAATATATTATTCTACATGAACTATCACATGTGAAAAGTCATGACTTAATATTCAACCAGCTTTATGTTGTTTTTAAAATGATATTCTGGTTTAATCCTGCACTATATATAAGTAAAACAATGATGGACAATGACTGTGAAAAAGTATGTGATAGAAACGTTTTAAAAATTTTGAATCGCCATGAACATATACGTTATGGTGAATCGATATTA
TRN  10010101110011000
NAM  Q8YAA1_LISMO/171-264
ASQ  PIFLGLKKNVIVIPDETF---SNVELHYIFKHELVHCKRKDMYYVWMVQFFTCIYWFNPLMYLMNKRIQMDRELACDEAVLATLSKSKYIGYGDTLL
DSQ  CCGATTTTTCTTGGGCTAAAAAAGAATGTAATAGTTATACCAGATGAAACTTTT---------TCAAACGTGGAATTGCATTATATTTTTAAGCATGAGCTCGTTCATTGTAAACGTAAAGATATGTATTATGTTTGGATGGTCCAATTTTTCACTTGTATCTATTGGTTTAACCCGTTGATGTATCTGATGAATAAGCGGATTCAAATGGATCGTGAATTAGCGTGTGATGAAGCTGTTTTAGCTACATTGTCGAAAAGTAAATATATTGGTTATGGCGATACGTTGCTT
TRN  10010101100011000
NAM  Q9K4N2_STAHA/170-266
ASQ  PITFWYGKYIILIPSSYFKSVIDKRLKYIILHEYAHAKNRDTLHLIIFNIFSIIMSYNPLVHIVKRKIIHDNEVEADRFVLNNINKNEFKTYAESIM
DSQ  CCAATAACTTTTTGGTATGGGAAATATATTATTTTGATTCCTAGTTCATATTTTAAAAGTGTAATTGACAAAAGACTAAAATATATAATATTGCATGAATATGCTCATGCTAAAAATAGAGATACTTTACATTTAATTATCTTTAATATCTTCTCTATTATTATGAGTTACAATCCATTAGTACATATTGTAAAAAGAAAGATAATTCATGACAATGAAGTAGAAGCCGATAGATTTGTCCTTAATAATATTAACAAAAATGAATTTAAAACTTATGCGGAATCTATTATG
TRN  10010101110011000
NAM  Q8RPJ4_DESHA/160-252
ASQ  PFVMGVLRPRIYLPASLS----GAEKEYILLHEQTHIRRFDHVVKILSFFVLCIHWFNPLVWAAFFLSGRDMEMSCDEAVIRKLGHEVKKDYSSSLL
DSQ  CCCTTTGTCATGGGGGTGCTTCGTCCCCGGATTTACTTGCCTGCCTCCCTTTCC------------GGCGCAGAGAAGGAGTATATCCTGCTCCATGAGCAGACCCATATCCGCCGGTTTGATCATGTGGTCAAGATCCTGAGCTTTTTTGTGCTTTGCATCCATTGGTTCAATCCCCTGGTGTGGGCGGCTTTTTTCCTTTCCGGCAGAGATATGGAAATGTCCTGCGACGAGGCAGTGATCAGGAAGCTGGGTCATGAGGTGAAAAAGGACTATTCCTCATCCCTCCTT
TRN  10010101100011001
NAM  Q8PED5_XANCP/181-276
ASQ  PQLIGPWQPVLLLPAARLPHMADDDLDMALTHELIHLRRGDLWWGLLPALAQHLFFFHPLVHLAACEYGIAREAACDAAVVAGHRH-CRHEYGRLLL
DSQ  CCGCAGTTGATCGGCCCGTGGCAACCGGTGTTGCTGTTGCCTGCTGCACGTCTGCCGCACATGGCCGATGACGATCTGGACATGGCGCTGACCCACGAGTTGATCCATCTGCGCCGTGGCGATCTGTGGTGGGGCTTGTTACCGGCATTGGCGCAGCACCTGTTCTTCTTCCACCCGCTGGTGCATCTGGCCGCGTGCGAATATGGCATCGCCCGCGAAGCCGCTTGCGATGCTGCCGTGGTCGCCGGGCACCGCCAT---TGCCGCCACGAGTACGGCCGCTTGTTGCTG
TRN  11011111101111110
NAM  Q9A4S6_CAUCR/151-246
ASQ  PAVMGALWPRIVLPADFTQRFDARERDLIVLHERTHIQRGDPIANLFIAGAGVLCWCNPMIALAQHFIRIDQELACDATVVALRSD-IRTDYARALM
DSQ  CCTGCCGTGATGGGCGCCCTGTGGCCGCGCATCGTCCTGCCCGCCGACTTCACCCAGCGCTTCGACGCCCGCGAGCGGGACCTGATCGTCCTGCACGAGCGCACCCACATCCAGCGCGGCGATCCGATCGCCAATCTGTTCATCGCCGGCGCCGGCGTCCTTTGCTGGTGCAATCCGATGATCGCCCTGGCCCAGCATTTCATCCGCATCGACCAGGAGCTGGCCTGCGACGCCACCGTGGTGGCCCTGCGCTCGGAC---ATCCGCACCGACTACGCCCGGGCCCTGATG
TRN  11011111101111111
NAM  Q9A2P8_CAUCR/140-235
ASQ  PMVLASPWPRIVAPADFDTRFQGEARDLVLAHERVHLARGDAQINALVVALQCLCWFNPLVHLGAHRLRLDQEMACDEAVLARRPE-ARRLYAETLL
DSQ  CCGATGGTGCTGGCCAGCCCCTGGCCGCGCATCGTGGCGCCCGCCGACTTCGACACCCGCTTTCAGGGCGAGGCGCGAGACCTGGTCCTGGCGCACGAGCGCGTCCACCTGGCGCGCGGCGACGCCCAGATCAACGCCCTGGTCGTCGCCCTCCAGTGCCTGTGCTGGTTCAATCCGCTGGTTCATCTGGGCGCGCATCGCCTGCGCCTGGACCAGGAAATGGCCTGCGACGAGGCCGTTCTCGCGCGCCGCCCCGAG---GCTCGGCGGCTCTATGCCGAGACCCTGCTC
TRN  11011111101111111
NAM  Q9A7T1_CAUCR/152-247
ASQ  PAVIGAVAPCVVLPADFDRQYTPEEQALILAHERNHLAVGDAQINAVVTGLQCLFWFNPFVHLGAATLRIDQEIACDAAVLARHPK-TRRAYGEAML
DSQ  CCCGCCGTGATTGGCGCCGTGGCGCCGTGCGTCGTGCTGCCGGCGGACTTCGACCGACAGTACACGCCCGAAGAGCAGGCCCTGATCCTGGCCCACGAGCGCAACCACCTCGCCGTCGGGGACGCCCAGATCAATGCCGTCGTGACCGGCCTGCAGTGCCTGTTCTGGTTCAATCCGTTCGTCCACCTTGGCGCGGCCACCCTGCGCATCGACCAGGAGATCGCCTGCGATGCGGCGGTGCTGGCCCGCCACCCCAAG---ACCCGCCGCGCCTATGGCGAAGCCATGCTG
TRN  11011111101111111
NAM  Q8PH97_XANAC/133-228
ASQ  PVSVGLWRPRIVLPMDFDTRYSAAERTLILAHERLHLRRGDLYANLLAALLLCIGWCNPLMHLAWRAFRLDQELACDAEVLTRYPG-KRRSYATAML
DSQ  CCGGTGTCTGTGGGTCTCTGGCGCCCACGCATCGTGCTGCCGATGGATTTCGATACGCGCTACAGCGCCGCCGAACGTACCTTGATCCTGGCCCACGAGCGCCTGCATCTGCGGCGCGGCGATCTGTATGCCAATCTGCTGGCGGCACTGTTGCTGTGCATCGGCTGGTGCAATCCGTTGATGCACCTGGCATGGCGCGCGTTTCGGCTGGATCAGGAACTGGCCTGCGACGCAGAGGTGCTGACGCGTTACCCAGGC---AAGCGCCGCAGTTACGCCACCGCGATGCTC
TRN  11011111101111111
NAM  Q8P5X8_XANCP/136-231
ASQ  PASLGVWRPRIVVPADFATRYSGVERQLIVAHERLHLRRGDLQANLFAAVLLCLGWCNPLVHLAWRAFRLDQELACDAGVLARHPR-LRRRYADAML
DSQ  CCGGCATCGCTCGGTGTGTGGCGGCCGCGCATCGTGGTGCCGGCCGACTTCGCCACGCGTTACAGCGGCGTGGAGCGTCAATTGATCGTGGCGCACGAGCGGCTGCATCTGCGCCGTGGCGATCTGCAGGCAAACCTGTTCGCCGCCGTGTTGCTATGCCTGGGCTGGTGCAATCCGCTGGTGCACCTGGCGTGGCGCGCATTCCGCCTGGATCAGGAGCTGGCCTGCGATGCCGGCGTGCTGGCACGGCATCCACGG---TTACGCCGCCGCTATGCCGACGCCATGCTC
TRN  11011111101111110
//