EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05543 - Peptidase_C47)
FAM  PF05543
PID  Peptidase_C47
DES  Staphopain peptidase C47
IPR  IPR008750
ANO  5
ALN  176
AID  0.619209
APH  (((STPA_STAAU/1-174:0.16559,Q9EWC9_STAEP/1-174:0.15979):0.03066,Q8RJP3_STAAU/225-399:0.07070):0.62675,Q8KLJ1_STAWA/222-396:0.08361,Q9EYW7_STAAU/219-393:0.13752);
ATP  (((STPA_STAAU/1-174,Q9EWC9_STAEP/1-174),Q8RJP3_STAAU/225-399),Q8KLJ1_STAWA/222-396,Q9EYW7_STAAU/219-393);
ATL  1.27462
DNO  4
DLN  528
DID  0.665803
DPH  ((Q9EWC9_STAEP/1-174:8.34396,Q8RJP3_STAAU/225-399:9.76409):29.43270,Q8KLJ1_STAWA/222-396:6.73605,Q9EYW7_STAAU/219-393:12.63056);
DTP  ((Q9EWC9_STAEP/1-174,Q8RJP3_STAAU/225-399),Q8KLJ1_STAWA/222-396,Q9EYW7_STAAU/219-393);
DTL  66.9053
RID  0.60334
RPH  (Q9EYW7_STAAU/219-393:0.14040,Q8KLJ1_STAWA/222-396:0.08280,(Q8RJP3_STAAU/225-399:0.08980,Q9EWC9_STAEP/1-174:0.15932):0.62412);
RTP  (Q9EYW7_STAAU/219-393,Q8KLJ1_STAWA/222-396,(Q8RJP3_STAAU/225-399,Q9EWC9_STAEP/1-174));
RTL  1.09645
LNK  Q8KLJ1_STAWA/222-396:Q8KLJ1:AJ293885
LNK  Q8RJP3_STAAU/225-399:Q8RJP3:AB071596
LNK  Q9EWC9_STAEP/1-174:Q9EWC9:AJ298299
LNK  Q9EYW7_STAAU/219-393:Q9EYW7:AF309515
LNK  STPA_STAAU/1-174:P81297:
AMK  .xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  ...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9EYW7_STAAU/219-393
ASQ  eDQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYEQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKIND-QEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY
DSQ  gaaGATCAAGTTCAATATGAAAATACATTAAAAAACTTCAAAATTAGAGAACAACAATTCGATAACTCATGGTGTGCAGGATTCAGTATGGCAGCATTATTAAATGCAACTAAAAATACAGACACTTATAATGCACATGATATTATGCGTACATTATACCCTGAAGTAAGTGAGCAAGACCTTCCTAATTGTGCAACATTCCCTAATCAAATGATTGAATACGGTAAATCACAAGGCAGAGATATTCATTATCAAGAAGGCGTACCATCATATGAACAAGTTGATCAACTTACAAAAGATAATGTAGGAATTATGATCCTTGCACAAAGTGTATCTCAAAACCCTAATGACCCACATTTAGGACATGCGCTAGCAGTTGTTGGTAATGCTAAAATTAATGAC---CAAGAAAAACTTATTTACTGGAATCCTTGGGATACAGAATTATCAATCCAAGATGCAGATTCAAGCCTATTACATTTATCATTCAATCGTGATTATAACTGGTATGGTTCAATGATAGGTTAC
TRN  10010101110011000
NAM  Q8KLJ1_STAWA/222-396
ASQ  dNQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDKYNAHDIMRTLYPNVSEEELPQFSTNPHQMIKYGNSQGRDIQHQSGMPSYNQIDQLTKDNKGAMILAHSVENNPNDPHLGHAMAVVGNAKINN-EDKLIFWNPWDTDLSIQDADSNLLHLSFNRDYTWDDTMIGY
DSQ  gacAATCAAGTTCAATATGAAAACACGTTAAAAAACTTCAAAATAAGAGAACAACAATTTGATAATTCATGGTGTGCTGGTTTTAGTATGGCAGCTCTACTGAATGCCACTAAGAATACAGATAAATATAATGCACACGATATTATGAGAACACTATACCCAAATGTTAGCGAAGAAGAATTACCACAATTCTCAACTAACCCACATCAAATGATTAAATACGGTAATTCACAAGGTAGAGACATTCAACATCAAAGTGGCATGCCTTCTTATAATCAAATTGATCAATTAACTAAAGATAATAAAGGCGCTATGATATTAGCTCATAGTGTTGAGAATAATCCTAATGATCCTCATCTTGGTCACGCTATGGCAGTTGTCGGTAATGCTAAAATTAATAAT---GAAGACAAACTGATTTTCTGGAATCCATGGGATACTGATTTATCTATTCAAGATGCAGACTCTAATTTACTTCATTTATCATTCAACAGAGACTATACATGGGACGACACAATGATAGGTTAT
TRN  10010101100011000
NAM  Q9EWC9_STAEP/1-174
ASQ  .MYAEYVNQLKNFRIRETQGYNSWCAGYTMSALLNATYNTNRYNAESVMRYLHPNLRGHDFQFTGLTSNEMLRFGRSQGRNTQYLNRMTSYNEVDQLTTNNQGIAVLGKRVESS-DGIHAGHAMAVAGNAKVNNGQKVILIWNPWDNGLMTQDAHSNIIPVSNGDHYEWYASIYGY
DSQ  ...ATGTACGCAGAATATGTAAATCAATTAAAGAATTTCAGAATACGAGAAACACAAGGGTATAATAGTTGGTGTGCCGGCTATACCATGTCAGCACTACTCAATGCCACATATAATACAAATCGATATAATGCAGAATCAGTAATGAGATATTTACATCCTAATTTAAGAGGTCACGACTTCCAATTTACAGGACTAACATCTAACGAGATGCTTCGTTTTGGTAGATCACAAGGCAGAAATACTCAATATCTTAATAGAATGACTTCATATAATGAAGTAGACCAATTAACAACTAATAATCAAGGTATAGCTGTATTAGGTAAGCGTGTTGAATCAAGC---GATGGTATTCACGCTGGACATGCCATGGCTGTGGCTGGTAATGCTAAAGTTAACAACGGACAAAAAGTCATTTTAATTTGGAACCCATGGGACAATGGTCTCATGACTCAAGATGCACATAGTAATATCATTCCAGTATCAAATGGCGATCACTATGAATGGTATGCATCAATTTATGGTTAT
TRN  10010101110011000
NAM  Q8RJP3_STAAU/225-399
ASQ  gVRAQYVNQLKNFKIRETQGNNGWCAGYTMSALLNATYNTDRYNAEAVMRYLHPNLQGDDFQFTGLTPQEMMKYGKSQGRDTQYLNRMPSYNEVDKLTTNNKDIAILGSRVEST-DGIHAGHAMAVVGNAELEGGQEVIMIWNPWDRGFMTQDAESNIIPVSNGDHYQWNSSIYGY
DSQ  ggaGTCCGAGCACAATATGTCAATCAATTAAAAAACTTTAAAATCAGAGAAACACAAGGTAATAATGGTTGGTGTGCTGGATATACAATGTCAGCATTACTGAATGCAACTTATAATACAGATCGTTATAATGCTGAGGCAGTAATGAGATATTTACATCCGAATTTACAAGGTGATGATTTCCAATTTACAGGTTTAACACCTCAAGAAATGATGAAGTATGGGAAATCACAGGGTAGAGATACTCAATATCTTAATAGAATGCCATCTTATAATGAAGTTGATAAATTGACTACTAATAATAAAGACATTGCTATTTTAGGAAGTCGTGTAGAATCAACA---GACGGTATTCATGCAGGACATGCTATGGCTGTAGTTGGTAATGCAGAATTAGAAGGTGGACAAGAAGTGATTATGATTTGGAACCCTTGGGACCGTGGTTTTATGACTCAAGATGCTGAAAGTAATATTATTCCAGTATCTAATGGAGATCATTATCAATGGAATAGTTCTATTTATGGGTAT
TRN  10010101100011000
NAM  STPA_STAAU/1-174
ASQ  .YNEQYVNKLENFKIRETQGNNGWCAGYTMSALLNATYNTNKYHAEAVMRFLHPNLQGQQFQFTGLTPREMIYFGQTQGRSPQLLNRMTTYNEVDNLTKNNKGIAILGSRVESR-NGMHAGHAMAVVGNAKLNNGQEVIIIWNPWDNGFMTQDAKNNVIPVSNGDHYQWYSSIYGY
//