EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05538 - Campylo_MOMP)
FAM  PF05538
PID  Campylo_MOMP
DES  Campylobacter major outer membrane protein
IPR  IPR008439
ANO  2
ALN  437
AID  0.757979
APH  (Q9F788_CAMJE/1-431:0.15658,Q9ZAN1_CAMJE/1-424:0.17814);
ATP  (Q9F788_CAMJE/1-431,Q9ZAN1_CAMJE/1-424);
ATL  0.33473
DNO  2
DLN  1311
DID  0.783094
DPH  (Q9F788_CAMJE/1-431:0.00000,Q9ZAN1_CAMJE/1-424:0.26000);
DTP  (Q9F788_CAMJE/1-431,Q9ZAN1_CAMJE/1-424);
DTL  0.26
RID  0.757979
RPH  (Q9F788_CAMJE/1-431:0.15658,Q9ZAN1_CAMJE/1-424:0.17814);
RTP  (Q9F788_CAMJE/1-431,Q9ZAN1_CAMJE/1-424);
RTL  0.33473
LNK  Q9F788_CAMJE/1-431:Q9F788:AF285129
LNK  Q9ZAN1_CAMJE/1-424:Q9ZAN1:U96452
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9F788_CAMJE/1-431
ASQ  MKLVKISLVAALAAGAFSAANATPLEEAIKDIDVSGVLRYRYESSNPWSNANFGSGISG-KQDHKYRAQVNFSGAISDNFKAFVQFDYNSQDGGYGTDSISNTSDTLTVRQLYLTYTNEDVATSVIAGKQQLNTIWTDNGIDGLVGTGVKVVNNSIDGLTLAAFAMDSFNEASDTTVTITQDNNQKITGVQFNRGNPKGDSDVSGALDWSKNIYGAAAIGSYDIAGGQFNPQLWLAYMSDNAFLYALDAAYSTTIFDGINWTIEGAYLGNSVDNKLKDRLDAANGNFFALRGTVEVNGWDASLGGLYYGKKDKVTLTTIEDQGNLGSLLAGEEIFYTNGSNLNGDIGRNIFGYVTAGYTFNETVRVGADFVYGGTKTNIIGQ--GGKKLEAVARVDYKYSPKLNFSAFYSYVNVD---TDPESTHHDAVRLQALYKF
DSQ  ATGAAACTAGTTAAAATTAGTTTAGTTGCAGCTCTTGCTGCAGGTGCTTTTTCAGCAGCTAACGCTACTCCACTTGAAGAAGCGATCAAAGATATCGATGTATCTGGAGTATTAAGATACAGATATGAAAGTAGCAATCCATGGAGCAATGCAAATTTTGGTTCTGGTATTTCTGGA---AAACAAGATCATAAATACAGAGCACAAGTTAACTTCAGCGGTGCTATATCAGACAACTTTAAAGCTTTCGTTCAATTTGACTACAACTCACAAGATGGTGGTTATGGCACAGATAGCATCAGTAACACAAGCGATACTTTAACAGTTCGTCAATTATATTTAACTTATACAAATGAAGATGTTGCTACAAGCGTAATCGCTGGTAAACAACAACTAAACACTATCTGGACTGACAATGGTATCGATGGTTTAGTTGGAACAGGTGTTAAAGTAGTAAACAACAGCATCGATGGTTTAACTCTAGCTGCTTTTGCAATGGATAGTTTCAATGAAGCTTCAGATACTACTGTAACAATTACTCAAGATAATAATCAAAAAATTACAGGAGTTCAATTTAATCGTGGAAATCCTAAAGGTGATAGTGATGTAAGTGGTGCTTTAGATTGGAGCAAAAATATTTATGGTGCTGCAGCTATCGGCTCTTATGATATCGCTGGTGGACAATTCAACCCACAATTATGGTTAGCTTATATGAGTGATAATGCATTCTTATATGCTTTAGATGCAGCTTATAGCACAACTATCTTTGATGGAATTAACTGGACTATCGAAGGTGCTTACCTAGGAAATTCTGTAGATAATAAACTTAAAGATAGATTAGATGCAGCAAATGGTAATTTCTTTGCTTTAAGAGGCACTGTTGAGGTAAATGGTTGGGATGCAAGTCTTGGTGGTTTATACTATGGTAAAAAAGATAAAGTTACTTTAACCACAATTGAAGATCAAGGTAATCTTGGCTCTTTGCTTGCAGGTGAAGAAATTTTCTATACTAATGGTTCTAATTTAAATGGCGATATTGGTAGAAATATCTTTGGTTATGTAACTGCTGGATATACTTTTAATGAAACAGTTCGCGTTGGTGCTGACTTTGTATACGGTGGAACAAAAACAAATATAATTGGTCAA------GGTGGTAAAAAACTTGAAGCTGTTGCAAGAGTAGATTACAAATACTCTCCAAAACTTAACTTCTCAGCATTCTACTCTTATGTAAATGTTGAT---------ACAGATCCTGAAAGCACTCATCATGATGCTGTAAGACTTCAAGCTCTTTACAAATTC
TRN  10010101110011000
NAM  Q9ZAN1_CAMJE/1-424
ASQ  MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVNNSNLNNNKQDHKYRAQVNFSAAIADNFKAFIQFDYNAVDGGTGVDNVTNAEKGLFVRQLYLTYTNEDVATSVIAGKQQLNLIWTDNAIDGLVGTGIKVVNNSIDGLTLAAFAVDSFMAEEQGADLLGQSTISTTQ------------KAAPFKVDSVGNLYGAAAVGSYDLAGGQFNPQLWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDKTH-ANGNLFALKGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNGDTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEDTAHVGGGKKLEAVARVDYKYSPKLNFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF
DSQ  ATGAAACTAGTTAAACTTAGTTTAGTTGCAGCTCTTGCTGCAGGTGCTTTTTCAGCAGCTAACGCTACTCCACTTGAAGAAGCTATCAAAGATGTTGATGTATCAGGTGTATTAAGATACAGATACGATACAGGTAATTTTGATAAAAATTTCGTTAACAACTCAAATTTAAACAACAACAAACAAGATCACAAATATAGAGCACAAGTTAACTTCAGTGCTGCTATAGCTGATAACTTCAAAGCTTTCATTCAGTTTGACTACAACGCTGTTGATGGTGGCACTGGTGTTGATAACGTAACAAATGCCGAAAAAGGACTTTTTGTTCGTCAATTATACTTAACTTATACAAATGAAGATGTTGCTACAAGTGTAATCGCTGGTAAACAACAATTAAACCTTATCTGGACGGATAACGCTATTGATGGTTTAGTAGGAACAGGTATCAAAGTAGTAAACAACAGCATCGATGGTTTAACTCTAGCTGCTTTTGCTGTAGATAGCTTTATGGCGGAAGAGCAAGGTGCAGATTTATTAGGACAAAGTACTATATCTACAACACAG------------------------------------AAAGCAGCTCCTTTTAAAGTGGATTCAGTAGGAAATCTTTATGGTGCTGCTGCTGTAGGTTCTTATGATCTTGCTGGCGGACAATTTAATCCACAATTATGGTTAGCTTACTGGGATCAAGTAGCATTCTTCTATGCTGTAGATGCAGCTTATAGTACAACTATCTTTGATGGAATCAACTGGACACTTGAAGGTGCTTACTTAGGAAATAGCCTTGATAGCGAACTTGATGATAAAACACAC---GCTAATGGCAATTTATTTGCTTTAAAAGGTAGCATTGAAGTAAATGGTTGGGATGCTAGCCTTGGTGGTTTATACTACGGTGATAAAGAAAAAGCTTCTACAGTCGTAATCGAAGATCAAGGTAATCTTGGTTCTTTACTTGCAGGTGAGGAAATTTTCTATACTACTGGTTCAAGACTAAATGGTGATACTGGTAGAAATATCTTCGGTTATGTAACTGGTGGATATACTTTCAACGAAACAGTTCGCGTTGGTGCTGACTTCGTATATGGTGGAACAAAAACAGAAGATACTGCTCATGTAGGTGGTGGTAAAAAACTTGAAGCTGTTGCAAGAGTAGATTACAAATACTCTCCAAAACTTAACTTCTCAGCATTCTATTCTTATGTGAACCTAGATCAAGGTGTAAACACTAATGAAAGTGCTGATCATAGCACTGTAAGACTTCAAGCTCTTTACAAATTC
TRN  10010101110011000
//