EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05523 - FdtA)
FAM  PF05523
PID  FdtA
DES  WxcM-like, C-terminal
IPR  IPR008894
ANO  8
ALN  135
AID  0.418431
APH  (((((Q9RGJ5_BACFR/8-138:0.49168,Q9RGJ6_BACFR/5-135:0.53467):0.19623,Q93S92_XANCP/176-306:0.75143):0.18755,Q9ALS3_CAMJE/1-131:0.62336):0.08196,(Q9ALS4_CAMJE/3-133:0.34171,Q9AEE5_LEPIN/7-139:0.44979):0.12888):0.31067,Q8PA23_XANCP/1-133:0.38517,O31013_VIBAN/1-131:0.26488);
ATP  (((((Q9RGJ5_BACFR/8-138,Q9RGJ6_BACFR/5-135),Q93S92_XANCP/176-306),Q9ALS3_CAMJE/1-131),(Q9ALS4_CAMJE/3-133,Q9AEE5_LEPIN/7-139)),Q8PA23_XANCP/1-133,O31013_VIBAN/1-131);
ATL  4.74799
DNO  8
DLN  405
DID  0.474464
DPH  (((((Q9AEE5_LEPIN/7-139:0.44267,Q9ALS4_CAMJE/3-133:0.20942):0.08930,Q9ALS3_CAMJE/1-131:0.33562):0.04370,(Q9RGJ5_BACFR/8-138:0.34193,Q9RGJ6_BACFR/5-135:0.35058):0.19834):0.37201,O31013_VIBAN/1-131:0.05735):0.39316,Q8PA23_XANCP/1-133:0.26704,Q93S92_XANCP/176-306:0.55662);
DTP  (((((Q9AEE5_LEPIN/7-139,Q9ALS4_CAMJE/3-133),Q9ALS3_CAMJE/1-131),(Q9RGJ5_BACFR/8-138,Q9RGJ6_BACFR/5-135)),O31013_VIBAN/1-131),Q8PA23_XANCP/1-133,Q93S92_XANCP/176-306);
DTL  3.65774
RID  0.418431
RPH  (((((Q9RGJ5_BACFR/8-138:0.49168,Q9RGJ6_BACFR/5-135:0.53467):0.19623,Q93S92_XANCP/176-306:0.75143):0.18755,Q9ALS3_CAMJE/1-131:0.62336):0.08196,(Q9ALS4_CAMJE/3-133:0.34171,Q9AEE5_LEPIN/7-139:0.44979):0.12888):0.31067,Q8PA23_XANCP/1-133:0.38517,O31013_VIBAN/1-131:0.26488);
RTP  (((((Q9RGJ5_BACFR/8-138,Q9RGJ6_BACFR/5-135),Q93S92_XANCP/176-306),Q9ALS3_CAMJE/1-131),(Q9ALS4_CAMJE/3-133,Q9AEE5_LEPIN/7-139)),Q8PA23_XANCP/1-133,O31013_VIBAN/1-131);
RTL  4.74799
LNK  O31013_VIBAN/1-131:O31013:AF025396
LNK  Q8PA23_XANCP/1-133:Q8PA23:AE012268
LNK  Q93S92_XANCP/176-306:Q93S92:AF204145
LNK  Q9AEE5_LEPIN/7-139:Q9AEE5:U61226
LNK  Q9ALS3_CAMJE/1-131:Q9ALS3:AF343914
LNK  Q9ALS4_CAMJE/3-133:Q9ALS4:AF343914
LNK  Q9RGJ5_BACFR/8-138:Q9RGJ5:AF125164
LNK  Q9RGJ6_BACFR/5-135:Q9RGJ6:AF125164
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q93S92_XANCP/176-306
ASQ  PGVKLYRMPSFADMR-GSLSVGNFDSFLPFNARRYFLVYGVPTQET-RGEHAHKRCHQFLICVSGSVRVLADDGTRR--IDVELNSPNQGIHLPPMIWGTQYKYSKDAVLLVFASEPYDSDEYIRDYADFKSLAN
DSQ  CCGGGGGTCAAGCTGTACCGGATGCCCAGTTTCGCCGACATGCGT---GGCTCGCTCTCCGTGGGAAATTTCGATAGTTTCCTGCCTTTCAATGCAAGACGGTATTTCCTGGTTTACGGCGTCCCCACCCAAGAGACC---CGTGGCGAACACGCGCACAAGCGCTGCCATCAGTTCCTGATCTGTGTATCCGGTTCAGTCAGAGTCCTTGCGGATGACGGCACCCGCCGT------ATCGACGTCGAACTCAACTCGCCGAACCAGGGCATCCACCTGCCGCCGATGATCTGGGGCACCCAATACAAGTACTCGAAGGACGCTGTTCTCCTGGTGTTTGCTTCCGAGCCCTACGATTCAGACGAATACATTCGCGATTACGCTGACTTCAAGAGTCTGGCGAAT
TRN  10010101100011001
NAM  O31013_VIBAN/1-131
ASQ  MDIKFIQFQAHGDDR-GSLVSLEDDKNIPFTIKRVYYLYNTKSGVR-RGFHAHKELKQLAVVLKGSCRFLLDDGSEK--IEVLLDNPEQGLFIDSFVWREMFDFSEDCVLLVLADKFYDEADYIRDYDAFLAEIK
DSQ  ATGGACATTAAATTTATTCAGTTTCAAGCTCATGGTGATGATAGG---GGCTCATTAGTCTCCTTAGAAGATGATAAAAATATCCCCTTTACTATAAAGAGAGTATATTATTTATACAATACAAAGTCTGGTGTACGC---CGCGGTTTTCACGCTCATAAAGAACTAAAACAGTTAGCCGTAGTTTTAAAAGGATCATGTAGATTCTTGTTAGATGACGGTAGCGAGAAG------ATTGAAGTTTTATTGGATAACCCTGAACAAGGCTTATTCATCGACTCGTTTGTTTGGAGAGAAATGTTCGATTTTTCTGAAGACTGTGTACTGCTGGTATTGGCAGATAAATTCTATGATGAAGCTGACTATATCCGTGATTATGATGCTTTCCTGGCAGAAATTAAG
TRN  10010101100011000
NAM  Q8PA23_XANCP/1-133
ASQ  MAIERIQLHTHGDDR-GLLISLEQQRNVPFEIRRVYYIFGTRQGVH-RGQHAHRQLNQLAVALHGSVTLLLDEGQGQGPEEVVLDDPSQGVLLGRMVWRDLHQFSEDCVLMVLADQYYDPGDYILDYDEFLTEAR
DSQ  ATGGCCATCGAACGCATCCAGTTGCATACGCACGGCGACGACCGC---GGGCTGCTCATTTCATTGGAGCAGCAGCGCAACGTCCCGTTCGAGATCCGTCGCGTGTACTACATCTTCGGTACGCGCCAGGGCGTGCAT---CGCGGCCAGCATGCGCACCGCCAGCTCAACCAATTGGCAGTTGCCCTGCATGGGTCGGTGACGCTGCTGCTGGATGAAGGCCAGGGCCAGGGCCCGGAAGAAGTGGTGCTGGACGACCCGTCGCAGGGCGTACTGCTCGGGCGCATGGTGTGGCGCGACCTGCACCAGTTCAGCGAGGACTGCGTGTTGATGGTGCTGGCCGACCAGTACTACGACCCGGGCGACTACATCCTGGACTACGACGAATTCCTCACCGAAGCCCGC
TRN  11011111101111101
NAM  Q9AEE5_LEPIN/7-139
ASQ  KNSGYINLKKIRDDRDGNLIILESLKDIPFEIKRVYYINNLENSVSVRGQHAHKQIEQAIFCVSGSFTLRLDDGKTK--QEILMNKDNVGVLLGKMLWHAMENFSSGCILLVAASDYYREDDYIRNYSDFIRLAG
DSQ  AAAAATTCAGGTTATATAAACCTAAAAAAAATCAGAGACGATAGAGACGGAAATTTAATTATATTAGAAAGTTTGAAAGATATACCTTTTGAAATAAAACGAGTTTATTATATTAATAATTTAGAAAACTCTGTAAGTGTAAGAGGCCAGCACGCTCATAAACAGATTGAACAAGCGATTTTTTGTGTTAGCGGGAGTTTTACCTTGAGATTAGATGATGGAAAAACAAAA------CAGGAAATTTTAATGAACAAAGATAATGTGGGAGTCCTTTTGGGAAAAATGCTTTGGCATGCTATGGAAAATTTTTCTTCCGGTTGTATCCTTCTTGTTGCCGCTTCGGATTATTATAGAGAAGACGATTACATAAGAAATTATTCTGATTTTATCAGGCTGGCTGGT
TRN  10010101100011000
NAM  Q9ALS4_CAMJE/3-133
ASQ  KNCKILNLRAIRDNR-GSLIALENNKEVPFEIKRVYYIFDTDPNFP-RGAHAHKNLEQVLIMMSGSCDIILNDGKNY--EKICLNRPDIGLYIGKNMWREMKNFSYGAKLLVLASDFYDEKEYIRNYDEFLRNIN
DSQ  AAAAATTGTAAAATTTTAAACTTAAGAGCCATAAGAGACAACAGA---GGTTCTTTAATAGCCCTAGAAAACAATAAAGAAGTTCCATTTGAAATAAAAAGAGTGTATTACATATTTGATACAGATCCAAATTTTCCA---AGAGGAGCACATGCACATAAAAATTTAGAGCAAGTGCTTATAATGATGAGTGGTTCTTGTGATATAATACTAAATGATGGAAAAAATTAT------GAAAAAATTTGCTTAAATCGTCCAGATATAGGACTTTATATAGGTAAAAATATGTGGAGAGAAATGAAAAATTTTTCTTATGGAGCAAAATTGCTAGTTTTGGCAAGTGATTTTTATGATGAAAAAGAGTATATAAGAAATTATGATGAATTTTTAAGGAATATTAAT
TRN  10010101110011010
NAM  Q9RGJ6_BACFR/5-135
ASQ  DNIKLIELPKFMDDR-GNLTFIEKGNQVPFDIRRVYMIYDVPGGEI-RGGHAYKKQVELVIALSGSFEVFLSDGFFE--RIYLLNRSYTGILIPAGIWRRLQNFSTNSLALVLASTSYQESDYIRDYKSFLEYRD
DSQ  GACAATATTAAGTTAATCGAGTTACCCAAATTCATGGATGATCGG---GGAAATTTAACATTCATAGAAAAAGGTAATCAAGTGCCTTTTGATATTCGAAGGGTATATATGATTTATGATGTTCCTGGTGGCGAAATT---AGAGGAGGTCATGCATATAAAAAACAAGTGGAGTTAGTCATTGCTTTGTCTGGAAGTTTTGAAGTTTTTTTAAGCGATGGATTTTTTGAG------CGCATTTATCTTTTAAATCGTTCTTATACGGGAATACTCATTCCTGCTGGTATATGGCGTAGGTTGCAAAACTTTTCAACAAATTCTCTTGCTTTAGTATTAGCTTCTACTTCTTATCAAGAGTCGGATTATATTCGTGATTATAAATCATTTTTGGAGTACCGTGAT
TRN  10010101110011000
NAM  Q9RGJ5_BACFR/8-138
ASQ  FDCSILELPRIKERC-GNITPIHGLIDLPFEIARVFYLYDIPGGED-RGAHAHKECQQFLIAASGSYEVELNDGINK--RTVLLNRPYYGLHIPPGIWAAERGFSSGSICLVLASHIYDELDYIRDYDEYKNYMQ
DSQ  TTTGATTGTTCAATATTAGAATTGCCTAGAATAAAAGAGCGTTGT---GGAAATATTACTCCTATACATGGACTAATAGATCTTCCTTTCGAAATTGCTCGTGTTTTTTATTTGTATGACATACCAGGAGGAGAAGAT---CGTGGTGCACATGCTCATAAAGAATGTCAACAGTTTCTGATTGCAGCTAGTGGTAGTTATGAAGTTGAACTAAATGATGGGATTAATAAA------AGGACTGTACTTTTAAATAGACCATATTATGGATTACATATTCCTCCTGGTATTTGGGCCGCTGAAAGAGGTTTTTCTTCGGGATCTATTTGTTTGGTCTTAGCTTCTCATATTTATGATGAGTTAGATTATATTCGTGATTATGATGAGTATAAAAATTATATGCAA
TRN  10010101100011000
NAM  Q9ALS3_CAMJE/1-131
ASQ  MNYTILKFKTINSKN-SILNVHQKDVNCPFEIKRIFYIYDFLDDSI-RGDHANLNSEFIFIALNGSCEILIDDGKTK--QKIILNNKTKGLYIDKMIWKQMYNFSKDCILLVLTNTYYDEKEYIYDYKYFCELKN
DSQ  TTGAACTATACAATATTAAAATTCAAAACCATAAATAGTAAAAAT---TCAATATTAAATGTCCATCAAAAAGATGTAAATTGTCCATTTGAAATTAAAAGAATTTTTTATATATATGATTTTTTAGATGATTCAATA---AGAGGTGATCATGCTAATTTAAATTCAGAATTTATTTTTATAGCTTTAAATGGAAGTTGCGAAATTTTAATAGATGATGGAAAAACAAAA------CAAAAAATAATATTAAACAATAAAACCAAAGGCTTATATATAGATAAAATGATATGGAAACAAATGTATAATTTTTCTAAAGATTGTATTTTATTGGTATTAACAAATACTTATTATGATGAAAAAGAGTATATTTATGATTATAAGTATTTTTGTGAATTAAAAAAT
TRN  10010101110011000
//