EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05413 - Peptidase_C34)
FAM  PF05413
PID  Peptidase_C34
DES  Putative closterovirus papain-like endopeptidase
IPR  IPR008744
ANO  2
ALN  92
AID  0.573034
APH  (Q9IMS9_9VIRU/844-935:0.33508,RRPO_ACLSP/843-934:0.28471);
ATP  (Q9IMS9_9VIRU/844-935,RRPO_ACLSP/843-934);
ATL  0.61979
DNO  2
DLN  276
DID  0.619565
DPH  (Q9IMS9_9VIRU/844-935:0.50463,RRPO_ACLSP/843-934:0.04322);
DTP  (Q9IMS9_9VIRU/844-935,RRPO_ACLSP/843-934);
DTL  0.54786
RID  0.573034
RPH  (Q9IMS9_9VIRU/844-935:0.51008,RRPO_ACLSP/843-934:0.10971);
RTP  (Q9IMS9_9VIRU/844-935,RRPO_ACLSP/843-934);
RTL  0.61979
LNK  Q9IMS9_9VIRU/844-935:Q9IMS9:AF170028
LNK  RRPO_ACLSP/843-934:P27738:M58152
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9IMS9_9VIRU/844-935
ASQ  KRKFIEGKYDCLFVAMAAMISKKPEDIMFKCLNTLDRCVMNKGCDLTDLRSICSGYEIKVECQGDCGLVEIGDIGLPLGKLILRGNHFTLCS
DSQ  AAGAGAAAATTTATAGAAGGTAAATATGATTGCCTCTTTGTTGCAATGGCCGCAATGATTTCAAAAAAACCAGAGGACATAATGTTTAAATGTCTTAACACTCTTGACAGATGTGTGATGAATAAGGGATGTGATCTCACTGACCTGAGGTCCATATGCAGTGGATATGAGATCAAAGTTGAATGTCAGGGTGATTGTGGTTTGGTGGAGATTGGGGATATTGGACTTCCCCTTGGCAAGTTGATTTTGAGGGGGAATCATTTCACCTTGTGTTCA
TRN  10010101100011001
NAM  RRPO_ACLSP/843-934
ASQ  KLRFIKGKFDCLFVSVAEIIHKKPEEIMMFIPHIMDRCVSNRGCSLDDAKAICEKYEIKIECEGDCGLVECGTSGLSIGRMLLRGNHFSVAS
DSQ  AAGCTTAGATTCATCAAGGGTAAATTCGACTGCCTATTTGTCAGTGTGGCTGAAATAATACACAAAAAACCAGAGGAAATCATGATGTTCATCCCACACATTATGGACAGGTGTGTGAGTAATAGGGGTTGCTCACTTGATGATGCAAAAGCAATATGTGAAAAATATGAAATCAAAATAGAGTGCGAAGGCGATTGCGGCTTGGTTGAGTGTGGGACATCAGGTCTTTCCATTGGAAGGATGCTGCTTAGGGGAAACCACTTTTCTGTCGCTTCA
TRN  10010101100011001
//