EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05405 - Mt_ATP-synt_B)
FAM  PF05405
PID  Mt_ATP-synt_B
DES  Mitochondrial ATP synthase B chain precursor (ATP-synt_B)
IPR  IPR008688
ANO  6
ALN  215
AID  0.305713
APH  (Q9IAJ7_XENLA/39-249:0.52103,((Q20053_CAEEL/94-300:0.18500,Q19126_CAEEL/96-302:0.07143):1.00251,(ATPF_YEAST/41-244:0.20893,ATPF_KLULA/34-233:0.20565):1.27754):0.56051,AT5F1_DROME/33-243:0.30298);
ATP  (Q9IAJ7_XENLA/39-249,((Q20053_CAEEL/94-300,Q19126_CAEEL/96-302),(ATPF_YEAST/41-244,ATPF_KLULA/34-233)),AT5F1_DROME/33-243);
ATL  4.33558
DNO  6
DLN  645
DID  0.436891
DPH  (Q9IAJ7_XENLA/39-249:0.42790,((Q20053_CAEEL/94-300:0.23587,Q19126_CAEEL/96-302:0.09966):0.41076,(ATPF_YEAST/41-244:0.25048,ATPF_KLULA/34-233:0.18241):0.71313):0.24831,AT5F1_DROME/33-243:0.28766);
DTP  (Q9IAJ7_XENLA/39-249,((Q20053_CAEEL/94-300,Q19126_CAEEL/96-302),(ATPF_YEAST/41-244,ATPF_KLULA/34-233)),AT5F1_DROME/33-243);
DTL  2.85618
RID  0.305713
RPH  (Q9IAJ7_XENLA/39-249:0.52103,((Q20053_CAEEL/94-300:0.18500,Q19126_CAEEL/96-302:0.07143):1.00251,(ATPF_YEAST/41-244:0.20893,ATPF_KLULA/34-233:0.20565):1.27754):0.56051,AT5F1_DROME/33-243:0.30298);
RTP  (Q9IAJ7_XENLA/39-249,((Q20053_CAEEL/94-300,Q19126_CAEEL/96-302),(ATPF_YEAST/41-244,ATPF_KLULA/34-233)),AT5F1_DROME/33-243);
RTL  4.33558
LNK  AT5F1_DROME/33-243:Q94516:AE003551
LNK  ATPF_KLULA/34-233:O13349:CR382125
LNK  ATPF_YEAST/41-244:P05626:X06732
LNK  Q19126_CAEEL/96-302:Q19126:U53340
LNK  Q20053_CAEEL/94-300:Q20053:Z46242
LNK  Q9IAJ7_XENLA/39-249:Q9IAJ7:AF187862
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  AT5F1_DROME/33-243
ASQ  ERRQRPEHPGKVRLGFLPEEWFQFFYNKTGVTGPYTFGVGLITYLCSKEIYVMEHEYYSGLSLGIMAIIAVKKLGPVIAKWADGEIDKIESEWKEGREAELKVLSDAIEAEKKEQWRADGALLLME----AKKENIALQLEAAFRERAMNVYSEVKRRLDYQVECRHVERRLSQKHMVNWITTNVLASISPQQEKETLNKCIADLSALALRVKSA
DSQ  GAGCGCCGCCAGCGCCCCGAGCATCCCGGCAAGGTCCGTCTGGGATTCCTGCCCGAGGAGTGGTTCCAGTTCTTCTACAACAAGACCGGTGTCACCGGACCCTACACCTTCGGCGTGGGTCTGATCACCTATCTCTGCTCCAAGGAGATCTACGTCATGGAGCACGAGTACTACAGCGGTCTGTCGCTCGGTATCATGGCCATCATTGCTGTCAAGAAGCTCGGCCCGGTCATCGCCAAGTGGGCTGATGGCGAGATCGATAAAATCGAATCTGAGTGGAAGGAGGGACGCGAGGCTGAGCTGAAGGTCCTCTCCGACGCCATCGAGGCCGAGAAGAAGGAGCAGTGGCGCGCCGACGGTGCCCTGCTGCTGATGGAA------------GCCAAGAAGGAGAACATTGCATTGCAGCTGGAGGCCGCGTTCCGTGAGCGCGCCATGAATGTGTACTCGGAGGTGAAGCGTCGTCTCGACTACCAGGTGGAGTGCCGCCACGTCGAGCGTCGCCTTAGCCAGAAGCACATGGTCAACTGGATCACCACCAATGTGTTGGCCAGCATCTCTCCCCAGCAGGAGAAGGAGACTCTCAACAAGTGCATCGCCGATCTGAGCGCTCTGGCACTGCGCGTCAAGTCTGCC
TRN  11011101101011011
NAM  Q9IAJ7_XENLA/39-249
ASQ  PVPPLPEKGGKVRFGLIPEELFQFLYPKTGVTGPYMLGTGLLVYLLSKEIYVINHESFAAASIGICIVYGIKKFGPSVAAFADKLNEEKVAKAQAVKDSAIKNLERAIEEEKKEQWRAEGRHHLFD----AKRNNVSVLLEINYRERLLNVFNEVKKRLDYQVALQHLQRRKEQDHMINWVEKNVVQSITPQQQKESIAKCITDLKLLAKTAQAR
DSQ  CCAGTGCCACCACTTCCAGAGAAAGGAGGGAAGGTCCGTTTTGGTTTGATCCCTGAAGAGCTTTTCCAATTTCTTTACCCCAAGACAGGCGTCACAGGTCCTTACATGCTGGGTACTGGTCTCCTTGTCTACCTTTTGTCAAAGGAAATATATGTCATAAATCATGAATCTTTTGCTGCTGCCTCAATTGGTATTTGCATTGTGTACGGAATCAAGAAATTTGGGCCCAGCGTAGCAGCCTTTGCTGACAAGCTCAATGAAGAGAAAGTTGCTAAGGCACAGGCAGTAAAAGATTCTGCAATTAAGAATCTGGAACGGGCTATTGAGGAAGAAAAGAAGGAACAGTGGAGGGCTGAAGGAAGACACCACCTCTTTGAT------------GCAAAAAGGAATAATGTGTCAGTGCTCCTGGAGATTAACTACAGAGAGAGACTTCTGAATGTCTTTAATGAGGTTAAGAAGCGCTTGGACTATCAGGTAGCTCTGCAACATCTCCAACGCCGCAAGGAGCAAGATCATATGATCAACTGGGTAGAAAAGAATGTGGTACAGAGTATCACACCCCAGCAGCAAAAGGAGAGCATTGCCAAATGTATCACGGACCTGAAACTTCTAGCCAAGACTGCACAAGCAAGA
TRN  10010101100011001
NAM  Q20053_CAEEL/94-300
ASQ  PYPSRPMYPPKTRLLMMPDSWFTAFQKVTGTSGPYLFFGGLFAFLVNKELWVFEEQGHMTVGWILFYLLVSRTAGYKIDAGLYKDYQERVGFFKGLIQEDLK---EAVDFRKTSAAQTASFAALKEGMPTSLKDSMQLQLEAAYRKNVQTISNEIKRRIEYLKETEETKARFERDQLLKLINDSVEKQVSQKDFQEKFLQNAIQ-----QLKGIA
DSQ  CCATACCCGTCTCGTCCAATGTACCCACCAAAGACTCGTCTCTTGATGATGCCCGATTCGTGGTTTACCGCATTCCAAAAGGTTACTGGTACCTCTGGTCCATATCTTTTCTTCGGAGGACTCTTTGCTTTCCTCGTTAACAAGGAGTTGTGGGTGTTTGAGGAGCAAGGACATATGACTGTTGGATGGATTCTTTTCTATCTTTTGGTTTCCAGAACCGCCGGCTATAAAATCGATGCTGGTCTTTACAAGGACTATCAGGAACGCGTTGGTTTCTTCAAAGGACTTATTCAAGAAGATTTGAAG---------GAAGCTGTTGATTTCCGCAAAACCTCTGCCGCTCAAACCGCTTCATTTGCTGCTCTCAAGGAAGGCATGCCAACTTCTCTCAAGGATTCCATGCAGCTACAGCTGGAGGCCGCTTATAGAAAGAATGTTCAAACCATTTCCAATGAGATCAAGCGTCGCATCGAGTATTTGAAAGAGACCGAGGAGACAAAGGCCAGATTTGAGCGCGACCAATTGCTGAAGTTGATCAATGACAGTGTCGAGAAGCAAGTCTCCCAGAAAGACTTCCAGGAAAAATTCCTTCAAAACGCCATTCAA---------------CAACTCAAGGGTATTGCT
TRN  10010101100011001
NAM  Q19126_CAEEL/96-302
ASQ  PYPARPMYPPKSRLLMMPDSWFTPFQKVTGVSGPYLFFGGLFAFLVNKELWVFEEQGHMTVGWILFYLLVTRTAGYKIDQGLYNGYQERVNFFKGLIQEDLK---EAVEFKKTSAKQTESLNSIKESYPTALKESMALQLEATYRKNVQSVATELKRRIDYLKETEESKARVEREQLLKLINSEVDKEFSDRSFKDKYLQNAIQ-----QLKGLN
DSQ  CCATACCCAGCCAGACCAATGTATCCACCAAAGTCTCGTCTTCTCATGATGCCAGACTCGTGGTTCACCCCATTCCAGAAAGTTACCGGAGTCTCCGGACCATACCTCTTCTTCGGAGGACTCTTCGCCTTCCTTGTCAACAAGGAGTTGTGGGTGTTTGAAGAGCAAGGGCACATGACTGTCGGATGGATTCTGTTCTATCTTTTGGTCACCAGAACTGCTGGATACAAGATCGACCAAGGATTGTACAATGGATACCAAGAGCGCGTCAACTTCTTCAAGGGACTCATCCAAGAAGATCTTAAG---------GAGGCTGTTGAGTTCAAGAAAACATCTGCCAAGCAGACCGAGTCTTTGAACTCCATCAAGGAATCCTACCCAACAGCACTCAAGGAGAGCATGGCCCTTCAACTTGAGGCCACATACAGAAAGAACGTCCAATCCGTGGCCACCGAATTGAAGCGCCGTATCGACTACCTCAAGGAGACCGAGGAGAGCAAGGCTCGCGTCGAGCGGGAGCAGCTCCTCAAGCTTATCAACAGCGAAGTGGACAAAGAATTCAGCGACCGATCGTTCAAGGACAAGTATCTGCAAAACGCCATTCAA---------------CAGCTTAAGGGATTGAAT
TRN  10010101100011011
NAM  ATPF_YEAST/41-244
ASQ  EKQTDPKAKANSIINAIPGN---NILTKTGVLG---TSAAAVIYAISNELYVINDESILLLTFLGFTGLVAKYLAPAYKDFADARMKKVSDVLNASRNKHVEAVKDRIDSVSQLQNVAETTKVLFD----VSKETVELESERFELKQKVELAHEAKAVLDSWVRYEASLRQLEQRQLAKSVISRVQSELGNPKFQEKVLQQSIS-EIEQLLSKLK
DSQ  GAAAAACAGACAGATCCAAAAGCAAAGGCTAACTCTATCATCAATGCCATTCCAGGTAAT---------AATATTTTGACAAAGACGGGGGTTTTGGGG---------ACTTCTGCTGCCGCTGTCATTTATGCCATTTCCAATGAATTGTACGTTATCAACGATGAAAGTATTTTATTGCTGACTTTTTTGGGTTTCACTGGTTTAGTGGCAAAGTATTTGGCGCCAGCATATAAAGATTTTGCCGATGCAAGAATGAAGAAAGTCTCCGACGTTTTAAATGCCTCGAGAAACAAGCATGTCGAAGCTGTTAAAGATAGAATCGACTCTGTCTCTCAACTACAAAATGTTGCTGAAACTACAAAGGTTTTGTTTGAT------------GTTTCCAAGGAAACTGTTGAACTTGAAAGCGAACGCTTTGAATTGAAACAAAAGGTAGAATTAGCTCACGAAGCAAAGGCAGTCTTAGATTCGTGGGTTAGATATGAAGCTTCCTTGCGTCAATTGGAACAAAGGCAACTAGCAAAATCTGTCATCTCCAGAGTTCAGTCAGAATTGGGTAATCCAAAATTCCAAGAGAAAGTTTTGCAACAGTCTATATCT---GAAATTGAACAATTGCTTTCTAAATTGAAG
TRN  10010101100011000
NAM  ATPF_KLULA/34-233
ASQ  PSPQDPKAKASSILDALPGN---TALSKTGILA---TSAAAAVYAISNQLYVLNEETILVATFTGVVLAGIKFLAPAYNEFAENRVKQVSSILNSSRTKHVDAVKERIESVSELKNVSDTTKVLFD----VSKETVKLEAEAFELKQQVDLAAEAKSVLDSWVRYEASVRQLQQQQIADSVVAKVQSELGNPKFQEKVLQQSVA-----DVEKLL
DSQ  CCATCACCACAAGATCCAAAGGCCAAGGCTTCTTCAATCTTGGATGCTTTGCCAGGTAAC---------ACTGCTTTGTCCAAGACTGGTATCTTGGCC---------ACCAGTGCTGCCGCTGCCGTGTATGCTATCTCTAACCAATTGTACGTTTTGAACGAAGAAACCATCTTGGTTGCTACTTTCACCGGTGTTGTGTTGGCTGGTATCAAGTTCTTGGCTCCAGCTTACAACGAATTCGCTGAAAACAGAGTTAAGCAAGTCAGCAGCATCTTGAACTCCTCCAGAACCAAGCATGTTGATGCTGTCAAGGAAAGAATCGAATCCGTTTCTGAATTGAAGAACGTTTCTGATACTACCAAGGTTTTGTTCGAT------------GTTTCCAAGGAAACTGTCAAGTTAGAAGCTGAAGCTTTCGAATTGAAGCAACAAGTTGACTTGGCTGCTGAAGCCAAGTCTGTATTGGACTCATGGGTCAGATACGAAGCCTCTGTTCGTCAATTACAACAACAACAAATCGCTGACTCCGTTGTCGCCAAGGTTCAAAGTGAATTGGGTAACCCTAAGTTCCAAGAAAAGGTCTTGCAACAATCCGTTGCT---------------GACGTGGAAAAGTTGTTG
TRN  10110101110011000
//