EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05386 - TEP1_N)
FAM  PF05386
PID  TEP1_N
DES  TEP1 N-terminal domain
IPR  IPR008850
ANO  7
ALN  30
AID  0.625674
APH  ((TEP1_RAT/1-30:0.26074,((TEP1_RAT/91-120:0.31880,TEP1_HUMAN/91-120:0.06042):0.04286,TEP1_HUMAN/31-60:0.25718):0.22019):0.01490,TEP1_MOUSE/61-90:0.13888,(TEP1_RAT/31-60:0.10878,TEP1_MOUSE/31-60:0.10854):0.06235);
ATP  ((TEP1_RAT/1-30,((TEP1_RAT/91-120,TEP1_HUMAN/91-120),TEP1_HUMAN/31-60)),TEP1_MOUSE/61-90,(TEP1_RAT/31-60,TEP1_MOUSE/31-60));
ATL  1.59364
DNO  7
DLN  90
DID  0.751323
DPH  ((TEP1_RAT/1-30:0.14649,((TEP1_RAT/91-120:0.26157,TEP1_HUMAN/91-120:0.01590):0.08648,TEP1_HUMAN/31-60:0.14686):0.08362):0.02259,TEP1_MOUSE/61-90:0.06360,(TEP1_RAT/31-60:0.06119,TEP1_MOUSE/31-60:0.05213):0.03975);
DTP  ((TEP1_RAT/1-30,((TEP1_RAT/91-120,TEP1_HUMAN/91-120),TEP1_HUMAN/31-60)),TEP1_MOUSE/61-90,(TEP1_RAT/31-60,TEP1_MOUSE/31-60));
DTL  0.98018
RID  0.625674
RPH  ((TEP1_RAT/1-30:0.26074,((TEP1_RAT/91-120:0.31880,TEP1_HUMAN/91-120:0.06042):0.04286,TEP1_HUMAN/31-60:0.25718):0.22019):0.01490,TEP1_MOUSE/61-90:0.13888,(TEP1_RAT/31-60:0.10878,TEP1_MOUSE/31-60:0.10854):0.06235);
RTP  ((TEP1_RAT/1-30,((TEP1_RAT/91-120,TEP1_HUMAN/91-120),TEP1_HUMAN/31-60)),TEP1_MOUSE/61-90,(TEP1_RAT/31-60,TEP1_MOUSE/31-60));
RTL  1.59364
LNK  TEP1_HUMAN/31-60:Q99973:U86136
LNK  TEP1_HUMAN/91-120:Q99973:U86136
LNK  TEP1_MOUSE/31-60:P97499:U86137
LNK  TEP1_MOUSE/61-90:P97499:U86137
LNK  TEP1_RAT/1-30:O08653:U89282
LNK  TEP1_RAT/31-60:O08653:U89282
LNK  TEP1_RAT/91-120:O08653:U89282
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  TEP1_HUMAN/31-60
ASQ  LEKLHQHVSTHSDILSLKNQCLATLPDLKT
DSQ  TTGGAGAAACTACATCAGCATGTATCTACCCACTCAGATATCCTCTCCTTGAAGAACCAGTGCCTAGCCACGCTTCCTGACCTGAAGACC
TRN  11011101101011001
NAM  TEP1_HUMAN/91-120
ASQ  MEKPHGHVSAHPDILSLENRCLATLPSLKS
DSQ  ATGGAGAAACCACATGGACATGTTTCTGCCCACCCAGACATCCTCTCCTTGGAGAACCGGTGCCTGGCCACCCTCCCTAGTCTAAAGAGC
TRN  11011101101011011
NAM  TEP1_RAT/91-120
ASQ  LEKLCGHMSSHPDVLSLENRCLATLPTVKR
DSQ  CTGGAGAAGCTATGTGGACATATGTCTAGTCACCCAGACGTCCTCTCTTTGGAGAACCGATGTCTTGCTACCCTCCCGACTGTAAAGAGA
TRN  10010101100011011
NAM  TEP1_RAT/1-30
ASQ  MEKLCGYVPVHPDILSLKNRCLTMLSDIQP
DSQ  ATGGAGAAACTCTGTGGTTATGTGCCTGTCCACCCAGACATCCTCTCCTTGAAGAATCGGTGCCTGACCATGCTCTCTGACATCCAACCC
TRN  11011101101011011
NAM  TEP1_MOUSE/61-90
ASQ  TERIDGHISVHPDILSLENRCLTMLPDLQP
DSQ  ACGGAGAGAATAGATGGGCATATATCTGTCCACCCAGACATCCTCTCCTTGGAGAATCGGTGCCTGACCATGCTCCCTGACCTCCAGCCT
TRN  10010101100011011
NAM  TEP1_MOUSE/31-60
ASQ  LEKIHGHRSVHSDILSLENQCLTMLSDLQP
DSQ  CTGGAGAAAATACATGGACATAGATCTGTCCACTCAGACATCCTTTCCTTGGAGAACCAGTGTCTGACCATGCTCTCTGACCTCCAGCCC
TRN  10010101100011001
NAM  TEP1_RAT/31-60
ASQ  LEKIHGQRSVNPDILSLENRCLTLLPDLQP
DSQ  CTGGAGAAAATACATGGACAGAGATCTGTCAACCCAGACATCCTGTCCTTGGAGAACCGGTGCCTGACCTTGCTCCCTGATCTCCAGCCC
TRN  10010101100011011
//