EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05381 - Peptidase_C21)
FAM  PF05381
PID  Peptidase_C21
DES  Tymovirus endopeptidase
IPR  IPR008043
ANO  13
ALN  114
AID  0.448702
APH  (((((((POLR_TYMVA/777-885:0.00873,O56254_TYMV/777-878:0.05140):0.02425,(POLR_TYMVC/777-885:0.00000,POLR_TYMV/777-885:0.00000):0.01279):0.29965,(POLR_OYMV/705-810:0.60313,POLR_KYMVJ/804-912:0.30754):0.20916):0.11018,(Q9QCX3_9VIRU/764-863:0.34237,(O91260_PHMV/865-972:0.31506,POLR_EPMV/772-877:0.35644):0.20767):0.16538):0.38950,Q8UZB6_9VIRU/808-916:0.61612):0.24220,P89920_9VIRU/733-842:0.44246):0.21214,Q9IW08_9VIRU/731-832:0.41357,Q91TW9_9VIRU/715-811:0.33299);
ATP  (((((((POLR_TYMVA/777-885,O56254_TYMV/777-878),(POLR_TYMVC/777-885,POLR_TYMV/777-885)),(POLR_OYMV/705-810,POLR_KYMVJ/804-912)),(Q9QCX3_9VIRU/764-863,(O91260_PHMV/865-972,POLR_EPMV/772-877))),Q8UZB6_9VIRU/808-916),P89920_9VIRU/733-842),Q9IW08_9VIRU/731-832,Q91TW9_9VIRU/715-811);
ATL  5.71154
DNO  12
DLN  342
DID  0.511195
DPH  (((((Q9QCX3_9VIRU/764-863:0.36164,(O91260_PHMV/865-972:0.22957,POLR_EPMV/772-877:0.39589):0.14577):0.06462,(((Q9IW08_9VIRU/731-832:0.38941,Q91TW9_9VIRU/715-811:0.30764):0.09627,P89920_9VIRU/733-842:0.29635):0.16254,Q8UZB6_9VIRU/808-916:0.34622):0.21308):0.10898,(POLR_OYMV/705-810:0.45255,POLR_KYMVJ/804-912:0.25795):0.13529):0.31122,POLR_TYMVC/777-885:0.01365):0.04058,O56254_TYMV/777-878:0.06986,POLR_TYMVA/777-885:0.00957);
DTP  (((((Q9QCX3_9VIRU/764-863,(O91260_PHMV/865-972,POLR_EPMV/772-877)),(((Q9IW08_9VIRU/731-832,Q91TW9_9VIRU/715-811),P89920_9VIRU/733-842),Q8UZB6_9VIRU/808-916)),(POLR_OYMV/705-810,POLR_KYMVJ/804-912)),POLR_TYMVC/777-885),O56254_TYMV/777-878,POLR_TYMVA/777-885);
DTL  4.43259
RID  0.429345
RPH  (((((Q9QCX3_9VIRU/764-863:0.34269,(O91260_PHMV/865-972:0.31334,POLR_EPMV/772-877:0.35651):0.20621):0.16483,((POLR_OYMV/705-810:0.60295,POLR_KYMVJ/804-912:0.30593):0.20953,((O56254_TYMV/777-878:0.05136,POLR_TYMVA/777-885:0.00871):0.02444,POLR_TYMVC/777-885:0.01258):0.29802):0.10958):0.38878,Q8UZB6_9VIRU/808-916:0.61518):0.24115,P89920_9VIRU/733-842:0.44175):0.21194,Q91TW9_9VIRU/715-811:0.33274,Q9IW08_9VIRU/731-832:0.41227);
RTP  (((((Q9QCX3_9VIRU/764-863,(O91260_PHMV/865-972,POLR_EPMV/772-877)),((POLR_OYMV/705-810,POLR_KYMVJ/804-912),((O56254_TYMV/777-878,POLR_TYMVA/777-885),POLR_TYMVC/777-885))),Q8UZB6_9VIRU/808-916),P89920_9VIRU/733-842),Q91TW9_9VIRU/715-811,Q9IW08_9VIRU/731-832);
RTL  5.69911
LNK  O56254_TYMV/777-878:O56254:AF035403
LNK  O91260_PHMV/865-972:O91260:Y16104
LNK  P89920_9VIRU/733-842:P89920:U87832
LNK  POLR_EPMV/772-877:P20126:J04374
LNK  POLR_KYMVJ/804-912:P36304:D00637
LNK  POLR_OYMV/705-810:P20127:J04375
LNK  POLR_TYMV/777-885:P10358:
LNK  POLR_TYMVA/777-885:P20128:J04373
LNK  POLR_TYMVC/777-885:P28477:X16378
LNK  Q8UZB6_9VIRU/808-916:Q8UZB6:AJ309022
LNK  Q91TW9_9VIRU/715-811:Q91TW9:AF265566
LNK  Q9IW08_9VIRU/731-832:Q9IW08:AJ271595
LNK  Q9QCX3_9VIRU/764-863:Q9QCX3:AF195000
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O56254_TYMV/777-878
ASQ  PQPT-LNCLLSAVSDQTKVSEDHLWESLQTILPDSQLRNEEINSLGLSTEHLTALAHLYNFQATVYSDRGPILFGPSDTIKRIDITHTTGPP----SHFSP-------GKRLLG
DSQ  CCACAACCCACC---CTGAATTGTCTCCTCTCTGCTGTCTCCGACCAAACCAAGGTTTCCGAGGACCACCTCTGGGAGTCTTTACAGACAATTCTCCCAGACAGCCAACTCAGGAACGAAGAGATCAACTCTCTCGGACTTTCAACTGAACACCTCACCGCGTTGGCCCATCTTTACAACTTCCAGGCAACTGTTTACTCCGATCGCGGTCCCATCCTCTTCGGCCCATCCGACACCATTAAGAGAATCGACATCACCCACACCACCGGACCACCA------------TCCCACTTTTCACCC---------------------GGCAAAAGACTTTTAGGC
TRN  10010101100011000
NAM  POLR_TYMVA/777-885
ASQ  PQPT-LNCLLSAVSDQTKVSEDHLWESLQTILPDSQLRNEEINSLGLSTEHLTALAHLYNFQATIYSDRGPILFGPSDTIKRIDITHTTGPP----SHFSPGKRLLGSQPSAKG
DSQ  CCACAACCCACC---CTGAATTGTCTCCTCTCTGCTGTCTCCGACCAAACCAAGGTTTCCGAGGATCACCTCTGGGAGTCCCTACAGACAATTCTCCCAGACAGCCAACTCAGGAACGAAGAGATCAACTCTCTCGGGCTTTCAACTGAACACCTCACTGCGTTGGCCCATCTTTACAACTTCCAGGCAACCATCTACTCCGATCGTGGTCCCATCCTCTTCGGCCCATCCGACACCATTAAGAGAATCGACATCACCCACACCACCGGACCGCCA------------TCCCACTTTTCACCCGGCAAAAGACTTTTAGGCAGCCAACCCTCAGCTAAGGGC
TRN  10010101100011000
NAM  POLR_TYMV/777-885
ASQ  PQPT-LNCLLSAVSDQTKVSEEHLWESLQTILPDSQLSNEETNTLGLSTEHLTALAHLYNFQATVYSDRGPILFGPSDTIKRIDITHTTGPP----SHFSPGKRLLGSQPSAKG
NAM  POLR_TYMVC/777-885
ASQ  PQPT-LNCLLSAVSDQTKVSEEHLWESLQTILPDSQLSNEETNTLGLSTEHLTALAHLYNFQATVYSDRGPILFGPSDTIKRIDITHTTGPP----SHFSPGKRLLGSQPSAKG
DSQ  CCACAACCCACC---TTGAATTGTCTTCTCTCCGCTGTCTCCGACCAAACCAAGGTTTCCGAGGAGCACCTCTGGGAGTCCCTACAGACAATTCTCCCAGACAGCCAACTCAGCAATGAAGAGACCAACACTCTCGGGCTTTCAACTGAACACCTCACTGCGTTGGCCCACCTTTACAACTTCCAGGCAACCGTTTACTCCGATCGCGGCCCCATCCTCTTCGGCCCCTCCGACACCATCAAGAGGATAGACATCACCCACACCACCGGACCGCCA------------TCCCACTTTTCACCCGGCAAAAGACTCCTAGGCAGCCAACCCTCCGCTAAGGGC
TRN  10010101110011001
NAM  POLR_KYMVJ/804-912
ASQ  PMPK-NNCLLTAVAPSLHINPHRLWTSLQEVLPDSLLSNSEIDSVGMSTDLLTALSHLFNFQAVVHSERGDILFGLQSAKTVIHIYHTNGPP----AHYSPPPKIIGSNSPPSS
DSQ  CCAATGCCCAAG---AACAACTGCCTTCTCACCGCAGTCGCCCCTTCCCTCCATATAAACCCTCACCGTCTCTGGACTTCCCTCCAGGAAGTCCTCCCAGATTCCCTCCTCTCCAACTCTGAGATAGACTCAGTCGGCATGTCCACCGATCTTCTCACAGCTCTCTCCCACCTCTTCAACTTCCAAGCCGTCGTCCACAGTGAACGTGGTGACATCCTCTTTGGCCTTCAGTCCGCCAAGACTGTCATCCACATCTACCACACCAACGGCCCCCCC------------GCTCATTACTCCCCCCCCCCCAAAATCATCGGCTCGAACTCCCCTCCTTCAAGC
TRN  10010101110011001
NAM  POLR_EPMV/772-877
ASQ  --PK-LNCLLTCFSELSGHSESDLWLSLQSILPDSQLQNPEVSTLGLSTDILTALCFIYHSSVTLHAPSGVYHYGIASSSTVYVIHYQPGPP----PHFSL-SPRLAASAPRCN
DSQ  ------CCAAAA---CTCAATTGCCTACTCACCTGCTTTTCTGAACTTTCAGGACACTCTGAGTCAGATCTTTGGTTGTCCCTGCAATCAATACTTCCTGACTCCCAACTCCAAAATCCTGAAGTCTCGACACTTGGCCTGTCCACTGACATTCTCACAGCTCTCTGCTTCATCTACCATTCATCTGTGACTCTCCATGCCCCCTCAGGAGTTTATCACTACGGCATAGCCTCCTCTTCTACCGTCTATGTCATCCACTATCAACCAGGCCCTCCT------------CCTCATTTTTCTCTC---TCCCCTAGACTTGCCGCTTCTGCTCCTCGCTGCAAC
TRN  10010101100011001
NAM  O91260_PHMV/865-972
ASQ  PIPK-NKCLLTAFSSQTHYSEESIWHTLQTLLPDSLLSNPEISTLGLSTDILTTLCYYYHLQAVVLCPNRELHFGITTSSQTITLSYEPGPP----RHFSS-RPRLLGSAPHSN
DSQ  CCCATCCCAAAA---AACAAGTGCCTTCTCACAGCCTTCAGCTCCCAAACTCACTATTCTGAAGAGTCCATCTGGCACACTCTTCAAACCCTCCTGCCTGACTCCCTTCTCTCCAACCCCGAAATCTCCACACTCGGGCTCTCCACCGACATCCTCACCACTCTCTGCTACTACTACCACCTGCAAGCCGTTGTTCTCTGCCCAAACAGAGAACTTCATTTCGGCATCACCACCTCTTCCCAGACCATCACCCTCTCCTACGAGCCCGGCCCCCCT------------CGCCACTTTTCTTCC---CGGCCTCGGCTCTTAGGCTCTGCCCCCCACTCCAAC
TRN  10010101100011010
NAM  Q9QCX3_9VIRU/764-863
ASQ  --PA-LCCLLEAFSSETKLPVDDLWLTLRSHLPDSLLSNSEISTYGLSTDLLTALCFFYHLRCSLHTNSGVLLFGIQNSEQHICITHTSGPP----AHYSP-------GARLNG
DSQ  ------CCAGCC---CTCTGTTGCCTCCTGGAAGCCTTCTCCTCCGAGACCAAGCTCCCAGTTGACGACTTGTGGCTCACGCTACGATCTCACCTCCCTGACTCCCTGCTTTCCAACTCTGAGATTAGCACCTATGGTCTTTCAACAGACTTGCTCACCGCTCTCTGTTTTTTTTACCACCTGCGCTGCTCTCTCCACACCAATTCTGGAGTCTTGCTCTTCGGAATTCAAAATTCCGAACAACACATCTGCATCACACACACTTCTGGCCCCCCA------------GCCCACTATTCTCCC---------------------GGAGCCCGCTTGAACGGC
TRN  11011111101111101
NAM  POLR_OYMV/705-810
ASQ  PFPQ-KHCLLTAVASQLSYTEHQLWEFLCDMLPDSLLTNSEVENFGLSTDHLTCLSYRLHFECIIHTSHSTIPYGIKKASTVIQISYIDGPP----KHFKA---FIKLAAAAPG
DSQ  CCCTTCCCCCAA---AAACACTGCCTTCTCACAGCTGTTGCTTCCCAACTCTCATACACTGAACACCAACTTTGGGAATTTCTTTGCGACATGCTCCCTGACTCCCTTCTAACCAATTCCGAAGTTGAAAACTTTGGCTTGAGCACCGATCATTTGACCTGCTTAAGCTATCGTCTTCACTTCGAATGCATCATTCACACCTCACATTCCACAATCCCCTATGGCATCAAGAAAGCTTCCACAGTCATCCAGATTTCCTACATCGATGGCCCCCCC------------AAACACTTTAAAGCT---------TTCATCAAACTTGCTGCCGCCGCTCCTGGC
TRN  11011101111011000
NAM  Q8UZB6_9VIRU/808-916
ASQ  PYPA-LDCLLVSCSAASGIPKEDLWATLCHIFPPSDL----VSDLGLSTNHLTALAFTYQWLVTLRSGELVQRHGLLSAPFAFEITHTPPVPPATVGHFALSAPLTPTSACLTG
DSQ  CCCTACCCCGCC---CTCGACTGCCTTCTGGTCTCCTGCTCCGCTGCCAGCGGAATCCCAAAGGAAGACCTCTGGGCCACCCTTTGCCACATCTTTCCCCCCAGTGATCTC------------GTCTCCGACCTTGGCCTCTCCACCAACCATCTCACCGCCCTCGCCTTCACCTACCAGTGGCTGGTCACTCTCCGCTCAGGAGAGTTGGTCCAGCGCCACGGCCTCCTCTCCGCCCCTTTCGCCTTTGAGATCACCCACACCCCACCCGTTCCTCCCGCCACCGTCGGGCACTTCGCCCTCTCCGCCCCCCTCACCCCCACCTCCGCTTGCCTCACCGGG
TRN  11011111101111101
NAM  P89920_9VIRU/733-842
ASQ  PYPA-MDCLLVATEQATRISREALWDCLTATCPDSFLDPKSIAQHGLSTDHFVILAHRFSLCANFHSAEHVIQLGMADATSIFMINHTAG-SAGLPGHFSL--RLGDQPRALNG
DSQ  CCATACCCCGCC---ATGGATTGCCTCCTCGTCGCCACCGAGCAAGCCACCCGCATCTCTCGAGAGGCCCTCTGGGACTGCCTCACAGCCACCTGCCCCGACTCATTCCTCGACCCCAAGAGCATCGCCCAGCATGGCCTCAGCACCGATCACTTCGTCATCCTCGCTCATCGCTTTTCCCTATGTGCCAACTTCCACTCCGCCGAGCACGTCATTCAGCTCGGGATGGCCGATGCCACCTCCATTTTCATGATCAACCACACGGCTGGC---TCCGCGGGCCTCCCGGGCCACTTCTCCCTC------CGCCTGGGTGACCAGCCCCGTGCCCTCAACGGT
TRN  11011111101111101
NAM  Q91TW9_9VIRU/715-811
ASQ  PYPTRAACLLVAVSQATGLPTRTLWAALCANLPDSVLDDGSLATLGLTTDHFAVLARIFSLRCRFVSEHGDVELGLHDATSRFTIRHTP-------GHFEL----------VAD
DSQ  CCTTACCCTACGAGGGCTGCCTGTCTCCTCGTGGCCGTCAGTCAAGCGACAGGGCTTCCCACCCGCACTCTCTGGGCAGCCCTCTGCGCCAACCTTCCGGATTCCGTTCTTGACGACGGTTCACTCGCCACCCTGGGCCTCACCACCGACCACTTCGCCGTCCTTGCTCGCATCTTCTCCTTGAGATGTCGCTTCGTCAGCGAGCATGGCGACGTTGAGCTCGGGCTTCATGACGCCACCTCTCGCTTCACGATCCGCCATACCCCT---------------------GGCCACTTCGAGCTC------------------------------GTGGCTGAC
TRN  10010101100011001
NAM  Q9IW08_9VIRU/731-832
ASQ  PIPVNQSCLLVAISKATSISLEELWKTLAALLPDSLLLPEDITTRGLSTDHFVVLASAHSLKCIFISGALELELGLHNAHHSFTIRHTS--SANQLPHFEL----------VAD
DSQ  CCAATCCCAGTGAACCAGAGTTGCCTCTTAGTGGCAATCAGCAAAGCCACCTCCATCTCGCTCGAAGAGTTGTGGAAGACCCTCGCTGCCCTCCTGCCCGATTCTCTCCTGTTGCCTGAGGACATAACGACCCGCGGCCTCTCCACGGACCACTTCGTAGTCTTGGCTTCCGCCCACTCTTTGAAGTGCATTTTCATCTCCGGGGCGCTCGAGCTCGAGTTAGGCCTCCACAACGCACACCACTCCTTCACAATCAGGCACACAAGC------TCGGCTAATCAACTGCCACACTTCGAGCTC------------------------------GTCGCGGAT
TRN  10010101100011010
//