EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05365 - UCR_UQCRX_QCR9)
FAM  PF05365
PID  UCR_UQCRX_QCR9
DES  Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
IPR  IPR008027
ANO  6
ALN  57
AID  0.344813
APH  ((UCR9_SCHPO/3-59:0.83067,(UCR9_YEAST/2-58:0.49913,(UCR10_SOLTU/13-69:0.85665,Q9XFY0_CHLPR/4-60:0.08920):0.51498):0.21633):0.22423,UCR10_BOVIN/6-62:0.37581,Q8SY81_DROME/1-55:0.30551);
ATP  ((UCR9_SCHPO/3-59,(UCR9_YEAST/2-58,(UCR10_SOLTU/13-69,Q9XFY0_CHLPR/4-60))),UCR10_BOVIN/6-62,Q8SY81_DROME/1-55);
ATL  3.91251
DNO  4
DLN  171
DID  0.483094
DPH  ((UCR10_SOLTU/13-69:0.47706,Q9XFY0_CHLPR/4-60:0.20842):0.29558,Q8SY81_DROME/1-55:0.38482,UCR9_YEAST/2-58:0.47948);
DTP  ((UCR10_SOLTU/13-69,Q9XFY0_CHLPR/4-60),Q8SY81_DROME/1-55,UCR9_YEAST/2-58);
DTL  1.84536
RID  0.367285
RPH  ((UCR10_SOLTU/13-69:0.84920,Q9XFY0_CHLPR/4-60:0.09895):0.46648,Q8SY81_DROME/1-55:0.54245,UCR9_YEAST/2-58:0.56818);
RTP  ((UCR10_SOLTU/13-69,Q9XFY0_CHLPR/4-60),Q8SY81_DROME/1-55,UCR9_YEAST/2-58);
RTL  2.52526
LNK  Q8SY81_DROME/1-55:Q8SY81:AY071727
LNK  Q9XFY0_CHLPR/4-60:Q9XFY0:AJ238626
LNK  UCR10_BOVIN/6-62:P00130:
LNK  UCR10_SOLTU/13-69:P46270:X79274
LNK  UCR9_SCHPO/3-59:O74433:
LNK  UCR9_YEAST/2-58:P22289:M59797
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9XFY0_CHLPR/4-60
ASQ  LDVFYKTIVRRNSVYVGFILVGAFFGEQAVDKVGNSLWESNNKGKLFKDIVASQQEA
DSQ  CTCGACGTTTTCTACAAGACCATCGTGCGAAGGAACAGCGTCTACGTAGGTTTCATCCTGGTTGGGGCCTTCTTCGGCGAGCAAGCCGTGGACAAGGTCGGCAACTCCCTCTGGGAGTCCAACAACAAGGGGAAGCTGTTCAAGGACATCGTGGCCTCACAGCAGGAGGCC
TRN  10010101100011001
NAM  UCR10_SOLTU/13-69
ASQ  LEGFYRLVMRRTPVYVTFVIAGALLGERAVDYGVKTLWEKNNVGKRYEDISVLGQRP
DSQ  CTTGAAGGATTTTACCGGCTCGTTATGCGCCGTACCCCTGTCTATGTTACCTTTGTCATCGCCGGCGCTTTGCTCGGCGAACGGGCGGTGGATTATGGGGTTAAAACACTCTGGGAGAAGAACAATGTTGGGAAGCGTTACGAGGATATTTCAGTTCTTGGACAGCGGCCT
TRN  11011101111011001
NAM  Q8SY81_DROME/1-55
ASQ  MKVIYNTLFKRASTYAVAIIASAFFFERALDVTSVAIFESINKGKLWKDIKGKYE--
DSQ  ATGAAGGTTATCTACAACACCCTGTTCAAGCGCGCCTCCACCTACGCCGTGGCCATCATCGCGTCGGCCTTTTTCTTCGAGCGCGCTCTCGATGTCACGTCGGTTGCGATTTTCGAGAGCATCAACAAAGGCAAACTCTGGAAGGACATCAAGGGCAAATACGAA------
TRN  11011101101011011
NAM  UCR10_BOVIN/6-62
ASQ  TARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENK
NAM  UCR9_YEAST/2-58
ASQ  FSSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAAG
DSQ  TTTTCATCACTATATAAAACCTTTTTCAAACGAAACGCTGTTTTTGTTGGTACTATCTTTGCAGGTGCCTTTGTTTTCCAAACTGTATTTGATACTGCTATTACTTCATGGTACGAGAATCACAACAAAGGAAAATTATGGAAAGATGTCAAGGCTCGAATAGCTGCAGGC
TRN  10010101110011000
NAM  UCR9_SCHPO/3-59
ASQ  SSTIYNIFFRRNSSFYATIFVSAFFAKIGFDVFTDSVWKRANAGLTWDEVKPRFLNK
//