EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05361 - PP1_inhibitor)
FAM  PF05361
PID  PP1_inhibitor
DES  PKC-activated protein phosphatase-1 inhibitor
IPR  IPR008025
ANO  4
ALN  147
AID  0.900838
APH  (PP14A_RAT/1-147:0.02062,PP14A_MOUSE/1-147:0.01437,(PP14A_PIG/1-147:0.02146,PP14A_HUMAN/1-147:0.07781):0.07152);
ATP  (PP14A_RAT/1-147,PP14A_MOUSE/1-147,(PP14A_PIG/1-147,PP14A_HUMAN/1-147));
ATL  0.20578
DNO  4
DLN  441
DID  0.869237
DPH  (PP14A_RAT/1-147:0.04769,PP14A_MOUSE/1-147:0.03137,(PP14A_PIG/1-147:0.05071,PP14A_HUMAN/1-147:0.07175):0.07790);
DTP  (PP14A_RAT/1-147,PP14A_MOUSE/1-147,(PP14A_PIG/1-147,PP14A_HUMAN/1-147));
DTL  0.27942
RID  0.900838
RPH  (PP14A_RAT/1-147:0.02062,PP14A_MOUSE/1-147:0.01437,(PP14A_PIG/1-147:0.02146,PP14A_HUMAN/1-147:0.07781):0.07152);
RTP  (PP14A_RAT/1-147,PP14A_MOUSE/1-147,(PP14A_PIG/1-147,PP14A_HUMAN/1-147));
RTL  0.20578
LNK  PP14A_HUMAN/1-147:Q96A00:AB056508
LNK  PP14A_MOUSE/1-147:Q91VC7:AY050672
LNK  PP14A_PIG/1-147:O18734:AB008376
LNK  PP14A_RAT/1-147:Q99MC0:AF352572
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  PP14A_RAT/1-147
ASQ  MAAQRLGKRVLSKLQSPSRARGPGGSPSGLQKRHARVTVKYDRRELQRRLDVEKWIDGRLEELYRGREADMPDEVNIDELLELDSEEERCRKIRGLLEACLNPTEDFVQELLAKLRGLHKQPGFPQPSPSDDPSLSPRQDPAHTAPP
DSQ  ATGGCAGCGCAGCGGCTGGGCAAGCGCGTGCTGAGCAAGCTGCAGTCCCCTTCGCGTGCCCGCGGCCCGGGGGGCAGCCCTAGTGGGCTGCAGAAGCGGCACGCGCGAGTCACCGTCAAATACGACCGGCGAGAGCTGCAGCGGCGACTGGACGTGGAGAAGTGGATCGACGGACGCTTGGAAGAGCTGTACCGCGGCAGGGAGGCAGACATGCCAGATGAGGTCAACATCGACGAGCTGCTGGAATTGGACAGTGAGGAGGAAAGATGCCGGAAAATCCGGGGACTCTTGGAGGCTTGCCTGAATCCCACAGAGGACTTCGTCCAGGAGCTATTGGCCAAGCTTCGGGGCCTGCACAAGCAGCCGGGCTTCCCGCAGCCCAGCCCCTCAGATGACCCCAGCCTGAGCCCCCGCCAGGACCCGGCTCACACTGCTCCACCG
TRN  10010101100011001
NAM  PP14A_MOUSE/1-147
ASQ  MAAQRLGKRVLSKLQSPSRARGPGGSPSGLQKRHARVTVKYDRRELQRRLDVEKWIDGCLEELYRGRESDMPDEVNIDELLELDSEEERCRKIQGLLEACANPTEDFVQELLAKLRGLHKQPGFPQPSPSDDPSLSPRQDRAHTAPP
DSQ  ATGGCTGCGCAGCGGCTGGGCAAGCGCGTGCTGAGCAAGCTGCAGTCCCCGTCGCGGGCCCGCGGCCCGGGGGGCAGCCCCAGCGGGCTGCAGAAGCGGCACGCGCGAGTCACGGTCAAGTACGACCGACGGGAGCTGCAGCGACGGCTGGACGTGGAGAAGTGGATCGACGGATGCTTGGAGGAGCTGTACCGCGGCAGGGAGTCAGACATGCCGGACGAGGTCAACATCGATGAGCTATTGGAATTGGACAGTGAAGAGGAAAGATGCCGGAAAATCCAGGGACTTCTGGAGGCTTGTGCAAATCCCACAGAGGACTTCGTCCAGGAGCTACTGGCCAAGCTTCGGGGCCTGCACAAACAGCCGGGCTTCCCGCAGCCCAGCCCCTCAGATGACCCCAGCCTGAGCCCCCGCCAGGACCGGGCCCACACTGCCCCACCC
TRN  10010101100011001
NAM  PP14A_HUMAN/1-147
ASQ  MAAQRLGKRVLSKLQSPSRARGPGGSPGGLQKRHARVTVKYDRRELQRRLDVEKWIDGRLEELYRGMEADMPDEINIDELLELESEEERSRKIQGLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLSPLQDRARTAHP
DSQ  ATGGCAGCTCAGCGGCTGGGCAAGCGCGTGCTGAGCAAGCTGCAGTCTCCATCGCGGGCCCGCGGGCCAGGGGGCAGTCCCGGGGGGCTGCAGAAGCGGCACGCGCGCGTCACCGTCAAGTATGACCGGCGGGAGCTGCAGCGGCGGCTGGACGTGGAGAAGTGGATCGACGGGCGCCTGGAGGAGCTGTACCGCGGCATGGAGGCAGACATGCCCGATGAGATCAACATTGATGAATTGTTGGAGTTAGAGAGTGAAGAGGAGAGAAGCCGGAAAATCCAGGGACTCCTGAAGTCATGTGGGAAACCTGTCGAGGACTTCATCCAGGAGCTGCTGGCAAAGCTTCAAGGCCTCCACAGGCAGCCCGGCCTCCGCCAGCCAAGCCCCTCCCACGACGGCAGCCTCAGCCCCCTCCAGGACCGGGCCCGGACTGCTCACCCC
TRN  10010101100011000
NAM  PP14A_PIG/1-147
ASQ  MAAQRLGKRVLSKLQSPSRARGPGGSPGGLQKRHARVTVKYDRRELQRRLDVEKWIDGRLEELYRGREADMPDEVNIDELLELESEEERSRKIQGLLKSCTNPTENFVQELLVKLRGLHKQPGLRQPSPSGDGSLSPRQDRARTAPP
DSQ  ATGGCAGCTCAGCGGCTGGGCAAGCGGGTGCTGAGCAAGCTGCAGTCTCCGTCGCGGGCCCGGGGGCCGGGGGGCAGCCCCGGGGGGCTGCAGAAGCGACACGCGCGTGTCACCGTCAAGTACGATCGGCGGGAGCTGCAGCGGCGGCTGGACGTGGAGAAGTGGATCGACGGGCGCTTGGAGGAGCTGTACCGTGGCAGGGAGGCAGACATGCCCGATGAAGTCAACATCGATGAACTGCTGGAATTAGAGAGTGAAGAGGAGAGAAGCCGGAAAATTCAGGGACTCCTAAAGTCATGCACGAACCCCACAGAGAACTTTGTCCAGGAGCTACTGGTGAAGCTGCGAGGCCTCCACAAGCAGCCGGGCCTCCGCCAGCCCAGCCCCTCCGGCGACGGCAGCCTGAGTCCCCGCCAGGACCGCGCCCGGACCGCGCCGCCC
TRN  10010101100011000
//