EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05359 - DUF748)
FAM  PF05359
PID  DUF748
DES  Domain of Unknown Function (DUF748)
IPR  IPR008023
ANO  7
ALN  164
AID  0.218757
APH  ((Q8Y0Z7_RALSO/183-342:1.72683,(Q8Y0Z7_RALSO/867-1024:0.41592,Q9HV64_PSEAE/688-844:0.58533):0.60117):0.24373,(Q8Y0Z7_RALSO/398-554:1.01271,Q9HV64_PSEAE/138-292:1.11209):0.25874,(Q9HV64_PSEAE/474-631:1.49892,Q8Y0Z7_RALSO/613-769:0.34539):0.34320);
ATP  ((Q8Y0Z7_RALSO/183-342,(Q8Y0Z7_RALSO/867-1024,Q9HV64_PSEAE/688-844)),(Q8Y0Z7_RALSO/398-554,Q9HV64_PSEAE/138-292),(Q9HV64_PSEAE/474-631,Q8Y0Z7_RALSO/613-769));
ATL  8.14403
DNO  7
DLN  492
DID  0.434854
DPH  ((Q9HV64_PSEAE/138-292:0.49644,((Q8Y0Z7_RALSO/183-342:0.60336,Q8Y0Z7_RALSO/398-554:0.50984):0.10179,(Q9HV64_PSEAE/474-631:0.56993,Q8Y0Z7_RALSO/613-769:0.37787):0.11929):0.07631):0.29249,Q8Y0Z7_RALSO/867-1024:0.31149,Q9HV64_PSEAE/688-844:0.29797);
DTP  ((Q9HV64_PSEAE/138-292,((Q8Y0Z7_RALSO/183-342,Q8Y0Z7_RALSO/398-554),(Q9HV64_PSEAE/474-631,Q8Y0Z7_RALSO/613-769))),Q8Y0Z7_RALSO/867-1024,Q9HV64_PSEAE/688-844);
DTL  3.75677
RID  0.218757
RPH  ((Q8Y0Z7_RALSO/183-342:1.72683,(Q8Y0Z7_RALSO/867-1024:0.41592,Q9HV64_PSEAE/688-844:0.58533):0.60117):0.24373,(Q8Y0Z7_RALSO/398-554:1.01271,Q9HV64_PSEAE/138-292:1.11209):0.25874,(Q9HV64_PSEAE/474-631:1.49892,Q8Y0Z7_RALSO/613-769:0.34539):0.34320);
RTP  ((Q8Y0Z7_RALSO/183-342,(Q8Y0Z7_RALSO/867-1024,Q9HV64_PSEAE/688-844)),(Q8Y0Z7_RALSO/398-554,Q9HV64_PSEAE/138-292),(Q9HV64_PSEAE/474-631,Q8Y0Z7_RALSO/613-769));
RTL  8.14403
LNK  Q8Y0Z7_RALSO/183-342:Q8Y0Z7:AL646061
LNK  Q8Y0Z7_RALSO/398-554:Q8Y0Z7:AL646061
LNK  Q8Y0Z7_RALSO/613-769:Q8Y0Z7:AL646061
LNK  Q8Y0Z7_RALSO/867-1024:Q8Y0Z7:AL646061
LNK  Q9HV64_PSEAE/138-292:Q9HV64:AE004887
LNK  Q9HV64_PSEAE/474-631:Q9HV64:AE004887
LNK  Q9HV64_PSEAE/688-844:Q9HV64:AE004887
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9HV64_PSEAE/688-844
ASQ  KPLGIHIGGVRINNGSANFADLTLMPPFGTAIQQLSGEVGTLDTRNS-QPAKVDIKGKVDKYAPVTIAGELDPFDPLKKLDITTSFKRVELTTLTPYSGKFAGYRIRKGRLNLDLHYQIERSQLKAENK-----VLLEGLQLGE-KVDSPDAVDLPVKLAVALL
DSQ  AAGCCGCTGGGCATCCACATCGGCGGCGTACGGATCAACAACGGCTCGGCGAACTTCGCCGACCTGACCCTGATGCCGCCGTTCGGTACCGCCATCCAGCAGCTCAGCGGCGAAGTCGGCACCCTCGACACGCGCAACTCG---CAGCCGGCCAAGGTGGACATCAAGGGCAAGGTCGACAAGTACGCACCGGTGACCATCGCCGGCGAACTGGACCCATTCGACCCGCTGAAGAAGCTCGACATCACCACCAGCTTCAAGCGCGTCGAGCTGACCACCCTGACGCCCTATTCCGGCAAGTTCGCCGGCTACCGCATCCGTAAGGGGCGACTCAACCTGGACCTGCACTACCAGATCGAACGTAGCCAACTGAAGGCGGAAAACAAG---------------GTCCTGCTGGAAGGCCTGCAACTCGGCGAG---AAGGTCGACAGCCCGGATGCTGTGGACCTGCCGGTGAAGCTGGCGGTAGCCCTGCTC
TRN  11011111101111111
NAM  Q8Y0Z7_RALSO/867-1024
ASQ  GGADLRIDAITLQDGNIRFTDNFIKPNYTANLTTIGGSVGTISTSAGQQPADVTLRGSVDGTAPVDIHGKVNPLAPTAFVDLSAKANDIELTNLTPYSAKYAGYPITKGKLTMDLHYLLDQGKLSADNH-----IFIDQLTFGE-RVESKDATNLPVRLAVALL
DSQ  GGCGGCGCGGACCTGAGAATCGACGCGATCACGCTGCAGGACGGCAACATCCGCTTCACCGACAACTTCATCAAGCCGAACTACACCGCCAACCTGACCACCATCGGCGGCTCGGTCGGCACCATCAGCACGTCGGCCGGCCAGCAGCCCGCCGACGTGACCCTGCGCGGCAGCGTGGACGGCACCGCGCCGGTCGACATCCACGGCAAGGTCAACCCGCTCGCGCCCACCGCGTTCGTCGACCTCTCCGCCAAGGCCAACGACATCGAGCTGACCAACCTGACACCCTACTCCGCAAAATACGCCGGCTACCCGATCACCAAAGGCAAGCTGACGATGGACCTGCACTACCTGCTCGACCAGGGCAAGCTGAGCGCGGACAACCAC---------------ATCTTCATCGACCAGCTGACCTTCGGCGAG---CGCGTGGAGAGCAAGGATGCGACCAACCTGCCGGTGCGGCTGGCGGTGGCGCTGCTG
TRN  10010101100011011
NAM  Q8Y0Z7_RALSO/613-769
ASQ  KPWAVTVQALRLDNGAIGFEDQTNSRPVKVRVEPLNVLVQNASTDLG-KPVDVQIGAGLGSKGKLDVRGNVVP--QPLKAELRVNAQNLSLAGFDPYLDKSLNAAITSALLTMDGHLALNQGKALTVNYQGN--ATLGNVRLQD-RVSSDDFLRW-RSLALNRI
DSQ  AAGCCATGGGCCGTGACCGTCCAGGCGCTGCGCCTGGACAACGGCGCGATCGGCTTTGAAGACCAGACCAACTCGCGACCGGTGAAGGTGCGCGTCGAACCGCTGAACGTGCTGGTGCAGAACGCCTCGACCGATCTCGGC---AAGCCGGTCGATGTGCAGATCGGCGCGGGACTGGGCAGCAAGGGCAAGCTCGACGTGCGCGGCAACGTGGTGCCG------CAACCGCTCAAGGCGGAGCTGCGCGTGAATGCGCAGAACCTGTCGCTGGCGGGCTTCGACCCGTATCTGGACAAATCGCTCAACGCGGCGATCACCAGCGCATTGCTGACGATGGACGGCCACCTCGCGCTCAACCAGGGCAAGGCGCTGACCGTGAACTACCAGGGCAAT------GCCACGCTCGGCAACGTGCGCCTGCAGGAC---CGCGTGAGCTCCGACGACTTCCTGCGCTGG---CGCTCGCTCGCGCTCAACCGCATC
TRN  11011101101011011
NAM  Q8Y0Z7_RALSO/398-554
ASQ  KPLDVAVGKLQLANSSVHWRDATTQPAADLVLDDLHGDAAVRTLG---GPTTLDVGAKLASGGTLNVKGSTSL--EKRTGELELKLEALKLAGIGPYLRQAGAPQLQNGALSADGKIALEFGADKFNVHAEPLVATLADLALA--PATRNDTALRAKQLRADIK
DSQ  AAGCCGCTCGACGTGGCGGTCGGCAAGCTGCAGCTGGCAAACAGCAGCGTCCACTGGCGCGATGCCACCACGCAGCCCGCAGCCGATCTCGTGCTGGACGACCTCCACGGCGACGCGGCCGTGCGCACCCTTGGC---------GGCCCGACCACGCTCGACGTAGGCGCGAAGCTGGCCAGCGGCGGCACGCTCAACGTCAAGGGCAGCACTTCGCTG------GAAAAACGCACCGGCGAGCTGGAGCTGAAGCTGGAGGCCCTCAAGCTCGCGGGCATCGGGCCTTACCTGCGCCAGGCCGGCGCGCCCCAGTTGCAGAACGGCGCACTGTCGGCAGACGGCAAGATCGCGCTGGAGTTCGGTGCCGACAAGTTCAACGTGCACGCGGAACCGCTGGTCGCCACGCTGGCCGATCTGGCGCTGGCG------CCGGCCACCCGCAACGACACCGCGCTGCGCGCCAAGCAATTGCGTGCCGACATCAAA
TRN  11011101101011011
NAM  Q8Y0Z7_RALSO/183-342
ASQ  EPARFVFANLQLNNGAIQFVDQPLGAQHTVDGLQIGVPFLASLPADV-DIFVQPLLAARIDGAPLHFAGKTKPFAQSLESSLNIKLDGLELPRYLGYVPGPLPVAVPQGKLTTDLTIDFQKPRTGNPVLRVHGTAGLDGLEVTD---TKKAPLVAAKQLRATLS
DSQ  GAGCCGGCGCGCTTCGTCTTCGCCAACCTGCAACTGAACAACGGCGCCATCCAGTTCGTCGATCAGCCGCTCGGGGCGCAGCACACCGTGGACGGGCTGCAGATTGGCGTGCCCTTCCTGGCGAGCCTGCCAGCCGACGTC---GACATCTTTGTGCAGCCGCTGCTGGCCGCGCGGATCGACGGCGCGCCACTGCATTTCGCCGGCAAGACGAAACCGTTTGCGCAGTCGCTCGAATCCAGCTTGAACATCAAGCTCGACGGCCTGGAACTGCCCCGCTACCTCGGCTACGTGCCGGGCCCCCTGCCGGTGGCCGTACCGCAGGGCAAGCTGACCACCGACCTGACGATCGACTTCCAGAAACCCCGCACCGGCAACCCCGTGCTGCGTGTGCACGGCACGGCCGGCCTCGATGGCCTGGAAGTGACCGAT---------ACCAAGAAGGCGCCCCTGGTGGCGGCCAAGCAACTGCGTGCGACCCTGTCC
TRN  11011101101011011
NAM  Q9HV64_PSEAE/474-631
ASQ  KPWNIVLRDAQLRGYKAHLVDRQPATEVPLEVGPLDLDLQNVDSLGK-TPFDLKLKTGLGNRGQVQASGQVVL--DPVSARLKVSTRDIDLRVAQAYISPFIRLELRSGFLGSELAVDLKSVEPLAFSVDGS--AEVSQLHTLD-TIKDRDFVKWTKLTLNGLA
DSQ  AAGCCCTGGAACATCGTCCTGCGCGACGCCCAGTTGCGCGGCTACAAGGCGCACCTGGTGGATCGCCAGCCGGCCACCGAGGTCCCGCTGGAAGTCGGCCCGCTGGACCTCGACCTGCAGAACGTCGACAGCCTCGGCAAG---ACCCCCTTCGACCTCAAGCTCAAGACCGGCCTCGGCAACCGCGGCCAGGTCCAGGCCAGCGGCCAGGTGGTGCTC------GACCCGGTCAGCGCCAGGCTCAAGGTCAGTACCCGCGACATCGACCTGCGCGTGGCCCAGGCCTACATCTCGCCGTTCATCCGCCTGGAACTGCGCAGCGGCTTCCTTGGCAGCGAGCTGGCGGTCGACCTGAAGAGCGTCGAGCCGCTGGCTTTCAGCGTCGACGGCAGC------GCCGAAGTCAGCCAGTTGCATACCCTGGAT---ACCATCAAGGACCGCGACTTCGTCAAATGGACCAAACTGACCCTCAACGGCCTCGCC
TRN  10010101100011011
NAM  Q9HV64_PSEAE/138-292
ASQ  DPFPLRIDRIQLAEGSLHFQDLRPSEPVDFSFDPLGFELHNLSTLPD-DGAKMTLVATGPNGGRLDWEGDLTL--VPITSRGHLSVKDIQLKAWWPYVRDNAPLVLENGVVSLSSDYRLDLSKDTQLLLDKA------ALKLADFSINSPQGKPLAKLASLDVA
DSQ  GACCCGTTCCCGCTGCGCATCGACCGCATCCAACTGGCCGAGGGCAGCCTGCACTTCCAGGACCTGCGACCGAGCGAGCCGGTGGACTTCAGCTTCGATCCGCTGGGCTTCGAGCTGCACAACCTCAGCACCCTGCCCGAC---GACGGCGCGAAGATGACCCTGGTCGCCACCGGCCCGAACGGCGGCCGCCTCGACTGGGAAGGCGACCTGACCCTG------GTGCCGATCACGTCCAGGGGCCACCTGAGCGTCAAGGATATCCAGCTCAAGGCCTGGTGGCCCTATGTCCGCGACAATGCCCCGCTGGTGCTGGAGAACGGCGTGGTCAGCCTCTCCAGCGACTATCGCCTGGACCTGTCCAAGGACACCCAACTGCTGCTCGACAAAGCC------------------GCGCTGAAACTCGCCGACTTCAGCATCAATTCGCCCCAGGGCAAGCCGCTGGCCAAGCTCGCCAGCCTCGACGTGGCC
TRN  10010101100011011
//