EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05356 - Phage_Coat_B)
FAM  PF05356
PID  Phage_Coat_B
DES  Phage Coat protein B
IPR  IPR008020
ANO  2
ALN  82
AID  1
APH  (Q9I5K5_PSEAE/1-82:0.00000,COAB_BPPF1/1-82:0.00000);
ATP  (Q9I5K5_PSEAE/1-82,COAB_BPPF1/1-82);
ATL  0
DNO  2
DLN  246
DID  0.99187
DPH  (Q9I5K5_PSEAE/1-82:0.00000,COAB_BPPF1/1-82:0.00820);
DTP  (Q9I5K5_PSEAE/1-82,COAB_BPPF1/1-82);
DTL  0.0082
RID  1
RPH  (Q9I5K5_PSEAE/1-82:0.00000,COAB_BPPF1/1-82:0.00000);
RTP  (Q9I5K5_PSEAE/1-82,COAB_BPPF1/1-82);
RTL  0
LNK  COAB_BPPF1/1-82:P03621:X52107
LNK  Q9I5K5_PSEAE/1-82:Q9I5K5:AE004507
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9I5K5_PSEAE/1-82
ASQ  MKAMKQRIAKFSPVASFRNLCIAGSVTAATSLPAFAGVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
DSQ  ATGAAAGCAATGAAGCAACGCATCGCCAAGTTCAGCCCGGTCGCCTCGTTCCGCAACCTGTGCATCGCCGGTTCCGTCACTGCCGCGACTTCGCTGCCGGCCTTCGCCGGGGTGATCGACACCAGCGCGGTGGAATCGGCGATCACCGATGGCCAGGGCGATATGAAGGCCATTGGCGGCTACATCGTCGGCGCCCTGGTGATCCTGGCCGTTGCCGGCCTGATCTACAGCATGTTGCGCAAGGCG
TRN  11011101101011011
NAM  COAB_BPPF1/1-82
ASQ  MKAMKQRIAKFSPVASFRNLCIAGSVTAATSLPAFAGVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
DSQ  ATGAAAGCAATGAAGCAACGCATCGCCAAGTTCAGCCCGGTCGCCTCGTTCCGCAACCTGTGCATCGCCGGCTCCGTCACTGCCGCGACTTCGCTGCCGGCCTTCGCCGGGGTGATCGACACCAGCGCGGTGGAATCGGCGATCACCGATGGCCAGGGCGATATGAAGGCCATTGGCGGCTACATCGTCGGCGCCCTGGTGATCCTGGCCGTCGCCGGCCTGATCTACAGCATGTTGCGCAAGGCG
TRN  11011101101011011
//