EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05321 - HHA)
FAM  PF05321
PID  HHA
DES  Haemolysin expression modulating protein
IPR  IPR007985
ANO  6
ALN  61
AID  0.446228
APH  (Q9F547_ECOLI/16-72:0.07623,((Q8XGJ8_SALTI/8-68:0.55459,Q935M6_SALTI/10-66:0.49437):0.29822,HHA_ECOLI/13-69:0.12756):0.21816,(Q47498_ECOLI/14-70:1.05542,O32581_ECOLI/10-66:0.16301):0.21353);
ATP  (Q9F547_ECOLI/16-72,((Q8XGJ8_SALTI/8-68,Q935M6_SALTI/10-66),HHA_ECOLI/13-69),(Q47498_ECOLI/14-70,O32581_ECOLI/10-66));
ATL  3.20109
DNO  6
DLN  183
DID  0.495517
DPH  (Q9F547_ECOLI/16-72:0.17285,((Q8XGJ8_SALTI/8-68:0.56205,Q935M6_SALTI/10-66:0.34075):0.19477,HHA_ECOLI/13-69:0.21070):0.10201,(Q47498_ECOLI/14-70:0.70143,O32581_ECOLI/10-66:0.26339):0.13553);
DTP  (Q9F547_ECOLI/16-72,((Q8XGJ8_SALTI/8-68,Q935M6_SALTI/10-66),HHA_ECOLI/13-69),(Q47498_ECOLI/14-70,O32581_ECOLI/10-66));
DTL  2.68348
RID  0.446228
RPH  (Q9F547_ECOLI/16-72:0.07623,((Q8XGJ8_SALTI/8-68:0.55459,Q935M6_SALTI/10-66:0.49437):0.29822,HHA_ECOLI/13-69:0.12756):0.21816,(Q47498_ECOLI/14-70:1.05542,O32581_ECOLI/10-66:0.16301):0.21353);
RTP  (Q9F547_ECOLI/16-72,((Q8XGJ8_SALTI/8-68,Q935M6_SALTI/10-66),HHA_ECOLI/13-69),(Q47498_ECOLI/14-70,O32581_ECOLI/10-66));
RTL  3.20109
LNK  HHA_ECOLI/13-69:P23870:X57977
LNK  O32581_ECOLI/10-66:O32581:Y13856
LNK  Q47498_ECOLI/14-70:Q47498:X72295
LNK  Q8XGJ8_SALTI/8-68:Q8XGJ8:AE016838
LNK  Q935M6_SALTI/10-66:Q935M6:AL513383
LNK  Q9F547_ECOLI/16-72:Q9F547:AP002527
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9F547_ECOLI/16-72
ASQ  FQLRRCSTLDTLEKIIEKNQNCLPPS-ELESFNAAADHRLAELTMN-KLYD--KVPPSVWK
DSQ  TTTCAGTTAAGACGTTGCTCAACACTCGACACACTTGAAAAGATTATTGAAAAAAACCAAAACTGCCTCCCCCCTTCT---GAGCTTGAGTCGTTTAATGCCGCAGCCGATCACAGGCTTGCGGAACTCACAATGAAT---AAACTCTACGAT------AAAGTCCCTCCATCCGTCTGGAAA
TRN  10010101110011000
NAM  HHA_ECOLI/13-69
ASQ  MRLRRCQTIDTLERVIEKNKYELSDN-ELAVFYSAADHRLAELTMN-KLYD--KIPSSVWK
DSQ  ATGCGTTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGTGTTATCGAGAAAAATAAATACGAATTATCAGATAAT---GAACTGGCGGTATTTTACTCAGCCGCAGATCACCGCCTCGCCGAATTGACCATGAAT---AAACTGTACGAC------AAGATCCCTTCCTCAGTATGGAAA
TRN  11011101101011000
NAM  O32581_ECOLI/10-66
ASQ  YQLRRCSSANTLEKIIRKNRDSLLNS-ERESFNSAADHRLAELITG-KLYD--RIPKEIWK
DSQ  TATCAGTTACGGCGATGTTCATCAGCCAATACGCTGGAAAAAATTATTCGTAAAAACAGAGACAGTTTATTAAACAGT---GAACGTGAATCATTTAATTCAGCAGCAGACCACCGGTTAGCGGAATTAATCACCGGA---AAGTTATATGAC------AGGATACCAAAAGAGATATGGAAA
TRN  10010101100011000
NAM  Q935M6_SALTI/10-66
ASQ  MKFRKCSSFDTLEKVFERLCEKNAGI-ASLEISGAYDHRKAELTMK-KLYD--KVPASVWT
DSQ  ATGAAATTTCGTAAGTGCTCTTCTTTCGACACACTGGAAAAAGTATTCGAACGACTCTGTGAAAAAAATGCAGGTATA---GCATCACTGGAAATTTCCGGGGCATATGACCATCGAAAAGCTGAACTGACAATGAAG---AAACTCTACGAT------AAAGTACCCGCAAGCGTATGGACA
TRN  10010101100011001
NAM  Q8XGJ8_SALTI/8-68
ASQ  LKFRKISSLESLEKLFDHLNYTLTDDMDIVNMYRAADHRRAELVSGGRLFDVGQVPQSVWR
DSQ  TTAAAATTCCGCAAAATTAGTTCGCTCGAAAGTCTGGAAAAACTGTTCGACCACCTTAACTATACCCTTACTGATGACATGGACATCGTTAATATGTATCGCGCTGCAGATCACCGCCGTGCCGAGCTGGTTTCCGGAGGACGCCTGTTTGATGTAGGTCAGGTTCCGCAATCCGTCTGGCGC
TRN  11011101101011010
NAM  Q47498_ECOLI/14-70
ASQ  HTVRRFMNEDSLDTYVDSKRDVLPAT-EFMRLLTAAEHRRVEIRTG-KLFD--KIPKGLFR
DSQ  CATACTGTCAGACGTTTCATGAATGAAGATTCGCTTGATACGTATGTAGACTCAAAACGTGATGTTCTACCTGCCACA---GAATTTATGCGTTTACTAACCGCGGCGGAACACCGCCGCGTTGAAATACGAACCGGC---AAGCTATTCGAT------AAAATCCCGAAAGGACTCTTCCGG
TRN  10010101110011000
//