EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05315 - ICEA)
FAM  PF05315
PID  ICEA
DES  ICEA Protein
IPR  IPR007979
ANO  2
ALN  230
AID  0.58209
APH  (T2N3_NEILA/1-230:0.62491,Q9L9W3_HELPY/1-227:0.09137);
ATP  (T2N3_NEILA/1-230,Q9L9W3_HELPY/1-227);
ATL  0.71628
DNO  2
DLN  690
DID  0.600587
DPH  (T2N3_NEILA/1-230:0.30637,Q9L9W3_HELPY/1-227:0.28200);
DTP  (T2N3_NEILA/1-230,Q9L9W3_HELPY/1-227);
DTL  0.58837
RID  0.58209
RPH  (T2N3_NEILA/1-230:0.48960,Q9L9W3_HELPY/1-227:0.22668);
RTP  (T2N3_NEILA/1-230,Q9L9W3_HELPY/1-227);
RTL  0.71628
LNK  Q9L9W3_HELPY/1-227:Q9L9W3:AF157549
LNK  T2N3_NEILA/1-230:Q51083:U59398
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  T2N3_NEILA/1-230
ASQ  MKITKTELFLRLAKPNEQGISRWVKTSEFAGEYKDLKLGNGGSWCRKDSPLARDYIVEFDKGLTSGNSIDAIRLNGFNQEKHFKQYIRKDIKDALKTRNCVMLGVNGKSENTKIEIDHKDGRKNNHRVSDIKTQKLEDFQPLCKAANDVKRQICKTCKETNKRWSAKNISGNPYAFYMGDENYSEELGCVGCYQYDPVEYRKSSVKRIAAEAAKYTSDYIFKKLYEEDNG
DSQ  ATGAAAATCACAAAAACAGAACTATTTTTAAGATTAGCCAAACCAAATGAACAAGGTATTTCCCGTTGGGTTAAGACAAGTGAATTTGCCGGGGAATATAAAGATTTGAAATTAGGTAATGGGGGAAGCTGGTGTCGGAAAGATTCTCCATTAGCGAGAGATTATATTGTTGAATTCGATAAGGGCCTTACTTCCGGCAATTCTATAGATGCAATCCGCCTTAATGGCTTTAATCAAGAAAAGCATTTTAAACAATATATCCGAAAAGATATCAAAGACGCGCTTAAAACAAGAAATTGTGTGATGTTGGGGGTTAATGGAAAATCTGAAAATACCAAGATTGAAATCGATCATAAAGACGGTAGGAAAAACAATCATCGTGTCAGTGACATTAAAACGCAAAAATTAGAAGATTTCCAACCGCTTTGCAAAGCAGCCAATGATGTCAAACGCCAAATCTGCAAAACCTGTAAAGAGACGAACAAGCGGTGGAGCGCTAAAAATATTTCGGGCAATCCCTATGCGTTTTATATGGGCGATGAAAATTATTCCGAAGAATTAGGCTGTGTCGGATGTTATCAATACGATCCCGTCGAATATCGAAAGTCCAGTGTTAAGAGAATTGCTGCCGAAGCGGCCAAATATACATCGGACTACATTTTTAAGAAATTATATGAAGAAGATAACGGA
TRN  10010101110011010
NAM  Q9L9W3_HELPY/1-227
ASQ  MSKSKKELFLELAQPDKNGVSRWVSAIEFIGKYQGLQLGNGGSWCRNNSSLAKEFKLEFDKRQTPGNSIDRIRLNGYNTRCVFNQSIHQDIKNYYSQQCCAMCGVRGNSENTQIEIDHKDGRKDDLRVSDLNTQTFDDFQALCKACNDKKRQICKKCKESGYRFDATKIPGNPYPFYEGEFEYD---GCVGCYQYDPIQYRKTCNDRIFNEGYQKGYYEGYQIGYNQKTT
DSQ  ATGAGTAAAAGTAAAAAAGAATTATTTTTAGAACTTGCGCAACCTGATAAAAACGGGGTGAGTCGTTGGGTAAGCGCTATAGAATTTATAGGAAAATATCAAGGATTACAGCTAGGTAATGGGGGGAGTTGGTGCAGGAATAACTCATCTTTGGCTAAAGAATTTAAATTAGAATTTGATAAAAGGCAAACTCCAGGAAATTCTATTGATAGAATACGCTTGAATGGCTATAATACTAGATGTGTTTTTAACCAAAGTATCCATCAAGACATTAAAAATTACTATAGCCAACAATGTTGTGCGATGTGCGGTGTGCGCGGCAACTCTGAAAACACTCAAATAGAAATAGATCATAAAGACGGCCGCAAGGATGATTTAAGAGTTTCTGATTTAAACACACAGACTTTTGATGATTTCCAAGCTTTATGTAAAGCTTGTAATGACAAGAAACGCCAGATTTGTAAAAAATGCAAAGAAAGTGGCTATAGATTTGATGCAACAAAAATTCCTGGCAATCCTTATCCTTTCTATGAGGGGGAGTTTGAATATGAT---------GGTTGTGTGGGTTGCTATCAGTATGACCCCATACAATACAGGAAAACTTGTAATGATAGGATATTTAATGAAGGGTATCAAAAAGGTTATTATGAGGGGTATCAAATTGGATACAATCAAAAAACTACT
TRN  10010101110011000
//