EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05301 - DUF738)
FAM  PF05301
PID  DUF738
DES  Protein of unknown function (DUF738)
IPR  IPR007965
ANO  5
ALN  123
AID  0.421483
APH  (Q9W5X9_DROME/77-195:0.40575,((Q9DCR0_MOUSE/3-123:0.24211,O45100_CAEEL/61-179:0.92507):0.20646,Q23192_CAEEL/64-183:0.89392):0.24873,Q9VSY4_DROME/72-191:0.12454);
ATP  (Q9W5X9_DROME/77-195,((Q9DCR0_MOUSE/3-123,O45100_CAEEL/61-179),Q23192_CAEEL/64-183),Q9VSY4_DROME/72-191);
ATL  3.04658
DNO  5
DLN  369
DID  0.489372
DPH  (Q9W5X9_DROME/77-195:0.22159,(Q9DCR0_MOUSE/3-123:0.28513,(Q23192_CAEEL/64-183:0.50685,O45100_CAEEL/61-179:0.55477):0.18044):0.24510,Q9VSY4_DROME/72-191:0.25748);
DTP  (Q9W5X9_DROME/77-195,(Q9DCR0_MOUSE/3-123,(Q23192_CAEEL/64-183,O45100_CAEEL/61-179)),Q9VSY4_DROME/72-191);
DTL  2.25136
RID  0.421483
RPH  (Q9W5X9_DROME/77-195:0.40575,((Q9DCR0_MOUSE/3-123:0.24211,O45100_CAEEL/61-179:0.92507):0.20646,Q23192_CAEEL/64-183:0.89392):0.24873,Q9VSY4_DROME/72-191:0.12454);
RTP  (Q9W5X9_DROME/77-195,((Q9DCR0_MOUSE/3-123,O45100_CAEEL/61-179),Q23192_CAEEL/64-183),Q9VSY4_DROME/72-191);
RTL  3.04658
LNK  O45100_CAEEL/61-179:O45100:AF045644
LNK  Q23192_CAEEL/64-183:Q23192:U39854
LNK  Q9DCR0_MOUSE/3-123:Q9DCR0:AK002569
LNK  Q9VSY4_DROME/72-191:Q9VSY4:AE003552
LNK  Q9W5X9_DROME/77-195:Q9W5X9:AE002611
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9VSY4_DROME/72-191
ASQ  SDN-QTIYLLADNEA--GHNGAVLGLLKVGTKNLYLFDEAGKTRMVEQTPSILDFYVHESRQRAGLGKRLFQTMLNEEQWTARKCSVDRPSEKLLSFLSKHYGLKRIIPQANNFVLYEGFFND
DSQ  TCCGACAAT---CAGACCATCTATCTGCTGGCAGATAATGAGGCG------GGTCACAATGGCGCCGTCTTAGGTCTGTTGAAGGTGGGCACCAAGAATCTCTATTTATTCGACGAAGCCGGAAAGACGCGCATGGTGGAGCAGACTCCATCCATTCTGGACTTCTATGTCCACGAGTCTCGTCAGCGTGCCGGACTGGGCAAGCGTCTCTTCCAAACGATGCTCAACGAAGAGCAGTGGACCGCACGCAAGTGCTCGGTGGATCGGCCGTCGGAAAAGCTACTGTCCTTCCTTAGCAAGCATTACGGATTAAAGCGAATCATTCCGCAAGCGAACAATTTCGTGCTCTACGAGGGATTCTTTAACGAT
TRN  11011111101111110
NAM  Q9W5X9_DROME/77-195
ASQ  ASD-QVVYLMADKAA---GHWEITGLLKVGTKDLFVFDQGGCYRRLNQTPAILDFYVHESRQRCGQGKLLFEWMLEKQGWSAHKCTVDRPSNKMLAFMAKHYGLVRTIPQGNNFVLYEGFFDD
DSQ  GCTTCCGAC---CAGGTGGTCTATCTAATGGCGGACAAAGCAGCG---------GGACACTGGGAAATCACCGGGTTGCTTAAGGTCGGCACCAAGGATCTCTTTGTATTCGACCAGGGGGGATGCTACCGGCGGCTTAATCAAACGCCAGCCATTCTGGATTTTTATGTACACGAGAGCCGCCAGCGCTGCGGCCAGGGAAAGCTGCTATTCGAATGGATGCTGGAGAAGCAGGGCTGGTCAGCGCACAAGTGCACTGTGGACCGACCGTCCAATAAGATGCTGGCCTTTATGGCCAAACACTATGGCCTGGTCCGCACCATTCCGCAGGGTAACAATTTTGTGCTCTACGAAGGTTTCTTCGACGAT
TRN  11011101101011001
NAM  Q9DCR0_MOUSE/3-123
ASQ  SNR-HVIYILKDTSARPAGKGAIIGFLKVGYKKLFVLDDREAHNEVEPL-CILDFYIHESVQRHGHGRELFQHMLQKERVEPHQLAIDRPSPKLLKFLNKHYNLETTVPQVNNFVIFEGFFAH
DSQ  AGCAACCGG---CACGTTATTTACATACTGAAGGACACCTCAGCCCGACCGGCAGGGAAAGGAGCCATTATTGGTTTCCTCAAAGTTGGATACAAGAAGCTCTTTGTACTGGATGACCGGGAGGCTCACAATGAGGTAGAACCCCTT---TGCATTCTGGACTTTTACATCCACGAGTCGGTGCAACGGCATGGCCACGGGCGAGAACTTTTTCAGCATATGTTACAGAAAGAGCGAGTGGAGCCCCACCAACTGGCCATTGACCGACCATCGCCGAAGCTGCTCAAGTTCCTGAATAAGCACTACAACCTGGAGACCACAGTCCCACAGGTGAACAACTTTGTCATCTTTGAAGGCTTCTTTGCCCAT
TRN  10010101100011000
NAM  Q23192_CAEEL/64-183
ASQ  HDEEQTTYIMWEKVN--GSKSILKGLLRVGYKTLYLTDNEQNQYM-EKAMCILDFFVVPTEQRSGNGFKMFDEMLKAENVTVDQCAFDKPSAALQQFLEKYYDRKDLVWQSNKYALCSNFFIG
DSQ  CATGACGAGGAGCAGACGACCTACATTATGTGGGAGAAAGTTAAT------GGAAGCAAAAGTATACTCAAAGGGTTGCTTCGAGTTGGATATAAAACGCTTTATCTGACAGATAATGAACAAAATCAGTACATG---GAAAAAGCAATGTGCATTTTGGACTTTTTCGTTGTGCCCACCGAACAACGCTCCGGAAATGGATTCAAAATGTTTGATGAAATGTTAAAAGCTGAAAACGTAACAGTAGACCAATGCGCATTCGACAAACCATCAGCTGCTCTCCAACAATTTCTAGAAAAATATTATGATAGAAAAGATTTGGTATGGCAATCAAACAAATATGCATTATGTTCAAATTTTTTCATTGGA
TRN  10010101100011000
NAM  O45100_CAEEL/61-179
ASQ  SDS-TLYLSWKYDEE--EKVSRLMGFAKVGRKKLFLYDSQMQTYE-GEILCLLDFYVHFSCQRQGVGQQILDYMFSQEHTEPYQLALDNPSVTLLGFMSQKYGLIKPVWQNTNFVVFEELFLA
DSQ  TCCGATTCA---ACTTTATATCTCTCTTGGAAATATGATGAAGAA------GAGAAGGTTAGTCGACTCATGGGATTCGCGAAAGTAGGAAGAAAGAAGTTATTCCTTTATGACTCTCAAATGCAGACTTATGAG---GGAGAGATTCTGTGTCTTCTGGACTTTTATGTTCACTTCTCATGTCAACGCCAAGGAGTTGGACAACAAATTCTAGATTACATGTTCTCTCAGGAACACACTGAACCTTATCAATTGGCTCTTGATAATCCATCAGTCACTCTTCTTGGTTTTATGTCACAAAAGTACGGACTTATCAAGCCTGTATGGCAGAATACCAATTTCGTTGTTTTCGAGGAGCTCTTCCTAGCT
TRN  10010101100011000
//