EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05275 - CopB)
FAM  PF05275
PID  CopB
DES  Copper resistance protein B precursor (CopB)
IPR  IPR007939
ANO  9
ALN  261
AID  0.440736
APH  (((Q8PGI5_XANAC/121-364:0.09735,Q8PCX5_XANCP/247-491:0.17359):0.13270,Q9PH13_XYLFA/84-324:0.64919):0.20186,(PCOB_ECOLI/52-296:0.48271,(((Q8XS24_RALSO/91-346:0.17322,Q9F3S0_9BURK/206-462:0.15868):0.23464,Q9L913_9GAMM/31-284:0.68076):0.17751,Q9A9L5_CAUCR/66-302:0.72590):0.16641):0.06720,Q56796_XANCA/96-339:0.32468);
ATP  (((Q8PGI5_XANAC/121-364,Q8PCX5_XANCP/247-491),Q9PH13_XYLFA/84-324),(PCOB_ECOLI/52-296,(((Q8XS24_RALSO/91-346,Q9F3S0_9BURK/206-462),Q9L913_9GAMM/31-284),Q9A9L5_CAUCR/66-302)),Q56796_XANCA/96-339);
ATL  4.4464
DNO  9
DLN  783
DID  0.506857
DPH  (((((Q8PGI5_XANAC/121-364:0.14198,Q8PCX5_XANCP/247-491:0.14140):0.08741,Q9PH13_XYLFA/84-324:0.46776):0.13304,((Q9L913_9GAMM/31-284:0.60659,PCOB_ECOLI/52-296:0.28245):0.20409,Q56796_XANCA/96-339:0.26795):0.07019):0.15030,Q9A9L5_CAUCR/66-302:0.41242):0.19722,Q8XS24_RALSO/91-346:0.13939,Q9F3S0_9BURK/206-462:0.25066);
DTP  (((((Q8PGI5_XANAC/121-364,Q8PCX5_XANCP/247-491),Q9PH13_XYLFA/84-324),((Q9L913_9GAMM/31-284,PCOB_ECOLI/52-296),Q56796_XANCA/96-339)),Q9A9L5_CAUCR/66-302),Q8XS24_RALSO/91-346,Q9F3S0_9BURK/206-462);
DTL  3.55285
RID  0.440736
RPH  (((Q8PGI5_XANAC/121-364:0.09735,Q8PCX5_XANCP/247-491:0.17359):0.13270,Q9PH13_XYLFA/84-324:0.64919):0.20186,(PCOB_ECOLI/52-296:0.48271,(((Q8XS24_RALSO/91-346:0.17322,Q9F3S0_9BURK/206-462:0.15868):0.23464,Q9L913_9GAMM/31-284:0.68076):0.17751,Q9A9L5_CAUCR/66-302:0.72590):0.16641):0.06720,Q56796_XANCA/96-339:0.32468);
RTP  (((Q8PGI5_XANAC/121-364,Q8PCX5_XANCP/247-491),Q9PH13_XYLFA/84-324),(PCOB_ECOLI/52-296,(((Q8XS24_RALSO/91-346,Q9F3S0_9BURK/206-462),Q9L913_9GAMM/31-284),Q9A9L5_CAUCR/66-302)),Q56796_XANCA/96-339);
RTL  4.4464
LNK  PCOB_ECOLI/52-296:Q47453:X83541
LNK  Q56796_XANCA/96-339:Q56796:L19222
LNK  Q8PCX5_XANCP/247-491:Q8PCX5:AE012155
LNK  Q8PGI5_XANAC/121-364:Q8PGI5:AE012013
LNK  Q8XS24_RALSO/91-346:Q8XS24:AL646080
LNK  Q9A9L5_CAUCR/66-302:Q9A9L5:AE005773
LNK  Q9F3S0_9BURK/206-462:Q9F3S0:AJ278983
LNK  Q9L913_9GAMM/31-284:Q9L913:AF187849
LNK  Q9PH13_XYLFA/84-324:Q9PH13:AE003866
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9PH13_XYLFA/84-324
ASQ  IHGATTQFAGDGSLPPPSAAAL----------AAAFPPLRHRAA--HAPPLVSLVRIDRLETWNADPGRGHAWATQAWIGSDIQRLWLRSQGECYGGR-CQSVAVEMLYGHDISPWWDALIGARRD-VQPD--GRTWAALGVQGVAPYKFESAAFLYLS-GAAMRLMVETKYDLLLSQRLILQPSLQATAGLTRD--RDLG.AGPQTLQVGIRMRYQITRRVAPYVGWEREYGYGESGRQARARGTSDHEKRWVAGIRCWF
DSQ  ATCCACGGTGCAACAACGCAATTCGCTGGAGATGGCTCCTTACCCCCTCCCAGCGCGGCGGCGTTG------------------------------GCAGCGGCGTTTCCTCCGTTACGCCACCGTGCTGCG------CACGCGCCACCCCTGGTGTCTCTGGTCCGTATTGATCGGTTGGAAACGTGGAATGCTGATCCCGGGCGCGGCCACGCTTGGGCAACGCAGGCATGGATTGGCAGCGACATTCAACGGCTGTGGTTACGTAGCCAAGGTGAGTGTTACGGTGGCCGA---TGCCAATCCGTCGCAGTGGAGATGCTGTATGGGCATGATATTTCGCCCTGGTGGGATGCTCTCATCGGCGCGCGCCGCGAT---GTGCAGCCGGAT------GGCCGCACCTGGGCGGCGCTTGGTGTGCAGGGCGTGGCACCATATAAATTTGAGAGTGCCGCGTTTCTGTATCTGAGC---GGTGCTGCGATGCGGCTCATGGTGGAGACTAAATATGACCTGCTACTCAGTCAGCGGTTGATCCTGCAACCGAGCCTCCAAGCGACCGCTGGTCTTACTCGGGAT------CGCGATCTGGGG...GCTGGACCCCAAACGTTACAGGTTGGGATCCGGATGCGTTACCAGATTACCCGGCGTGTTGCACCGTATGTGGGTTGGGAGCGCGAATATGGTTATGGGGAGAGTGGGCGCCAGGCACGCGCGCGTGGTACGTCTGACCATGAAAAGCGCTGGGTAGCTGGCATACGCTGCTGGTTT
TRN  10010101100011010
NAM  Q8PCX5_XANCP/247-491
ASQ  HTAPAATRSPREPIPTPTADDI----------AAAFAPLRSHAM--HGAGINHYVLLDRLEASDNHTGSGQDWEARAWLGGDIDRLWLRSEGERRRDQ-THDASLEAFYGHAISPWWDVLLGARQD-LAPGQ-RQSWAAIGVQGLAPYKFETEATLYLGSGGRAAFRLEAEYDVLLTNRLILQPRVEADVALTDDDRRGIG.SGLEEVEAGLRLRYEITRKFAPYIGWVHSRRFGDSAQRADGDDTPARESRFVAGVRVWF
DSQ  CACACCGCGCCGGCCGCAACCAGATCGCCACGCGAGCCGATCCCTACTCCCACCGCAGACGACATT------------------------------GCCGCGGCGTTTGCACCGCTGCGCAGTCATGCCATG------CATGGAGCAGGCATCAATCACTACGTGTTGCTCGACCGACTGGAGGCCTCCGACAACCACACCGGCAGCGGCCAGGACTGGGAAGCGCGCGCCTGGCTCGGCGGTGACATCGACCGGCTGTGGCTGCGCAGCGAAGGCGAGCGCCGGCGCGACCAG---ACCCACGACGCCTCGTTGGAAGCCTTCTACGGCCATGCCATCTCGCCGTGGTGGGATGTCCTGCTCGGCGCGCGCCAGGAT---CTCGCGCCCGGCCAG---CGGCAGAGCTGGGCCGCCATCGGCGTGCAGGGGCTGGCCCCGTACAAGTTCGAAACCGAAGCCACGCTCTATCTAGGCAGCGGCGGCCGCGCGGCGTTTCGGCTGGAAGCCGAGTACGACGTGCTGCTCACCAATCGCTTGATCCTGCAGCCGCGCGTGGAAGCCGACGTCGCACTTACCGACGATGACCGGCGCGGCATCGGC...AGCGGGCTGGAAGAGGTCGAAGCAGGCCTGCGGCTGCGCTACGAGATCACACGCAAATTCGCGCCATATATCGGCTGGGTGCACAGCCGCCGTTTCGGCGATAGCGCACAACGCGCCGACGGTGATGACACTCCCGCCCGCGAATCGCGCTTCGTCGCCGGCGTGCGGGTGTGGTTC
TRN  10010101100011011
NAM  Q8PGI5_XANAC/121-364
ASQ  TETRT-NPLPRAPIPPTTADDI----------AAAFAPLRTHTM--HSAGINHYVLLDRLEASNTNRGSGQAWESRAWIGGDVDRLWLRSEGERHDGR-TESASLEAFYGHAISPWWDVLVGARQD-IGAGE-HRSWAAFGVQGLAPYKFETEATLYVGTGSRAALRLEGEYEVLLTNRLILQPRVEADIALTDDNRRGIG.SGLEQVELGLRLRYEITRRFAPYIGWMHSRSFGDSAQRAAMDDIRARDSRFVAGVRVWF
DSQ  ACCGAGACACGCACT---AACCCGCTACCACGCGCCCCCATCCCCCCAACCACGGCGGACGACATC------------------------------GCCGCTGCATTCGCACCATTGCGCACGCATACGATG------CACTCGGCAGGTATCAATCATTATGTCCTGCTCGATCGGCTGGAGGCTTCCAACACTAACCGCGGTAGCGGCCAGGCCTGGGAATCACGCGCATGGATCGGTGGCGACGTCGACCGGCTCTGGCTGCGCAGCGAAGGCGAACGGCACGACGGGCGC---ACCGAATCCGCCTCGCTGGAAGCGTTCTATGGCCATGCCATTTCGCCGTGGTGGGATGTGCTTGTCGGCGCGCGCCAGGAC---ATCGGCGCAGGAGAA---CATCGCAGCTGGGCGGCTTTCGGCGTGCAAGGACTGGCGCCCTACAAGTTCGAAACCGAAGCCACGCTATATGTGGGCACCGGCAGCCGCGCGGCGCTGCGGCTGGAAGGCGAATACGAGGTACTGCTGACCAACCGCCTGATCCTGCAGCCGCGTGTGGAAGCCGACATCGCGCTTACCGACGACAACCGCCGCGGTATTGGC...AGCGGCCTGGAACAGGTCGAACTTGGCTTGCGCCTGCGCTACGAGATCACCCGCCGCTTCGCGCCGTACATCGGCTGGATGCACAGCCGCAGCTTCGGCGATAGCGCACAGCGCGCGGCGATGGACGATATCCGCGCGCGCGACAGCCGCTTTGTTGCCGGAGTGCGCGTTTGGTTT
TRN  11011111101111101
NAM  Q56796_XANCA/96-339
ASQ  GHSAT-TSEPRTPIPKVTDIDR----------AAAVPPPSDHPV--HDNTIQHYVLFNRLEAWNADPGTGQAWEGQSWIGTDLNRLCVRSEGERNDGR-TEAADLEVLYGRSVAPWWDLVAGIRQD-FKPGS-SQTYAAFGVQGLAPMKFEVAATAYIGERGQTAARLEAEYELLLTNRWILQPLAEIELFGKDDPARGIG.SGLSTAELGLRLRYEFTRQFAPYIGLVYERAFGNTADLRRDESERVDDTRIVVGIRTWF
DSQ  GGGCATAGCGCCACC---ACGAGCGAGCCGCGCACGCCTATCCCGAAGGTGACCGACATCGACCGA------------------------------GCCGCTGCGGTACCACCACCCAGCGATCATCCCGTC------CATGACAACACAATTCAGCATTACGTATTGTTCAACCGGCTTGAGGCCTGGAATGCCGACCCCGGCACCGGTCAAGCATGGGAAGGCCAAAGCTGGATTGGTACCGACCTCAATCGCCTGTGCGTGCGCAGTGAAGGAGAGCGCAATGATGGTCGT---ACCGAGGCGGCGGATCTGGAAGTGCTCTATGGACGAAGCGTTGCGCCTTGGTGGGATCTAGTTGCCGGTATTCGTCAGGAC---TTCAAGCCAGGGAGC---TCGCAAACCTATGCCGCTTTTGGCGTGCAGGGGCTGGCGCCAATGAAGTTCGAGGTGGCTGCCACCGCCTATATTGGCGAGCGCGGCCAGACAGCGGCCAGATTAGAAGCTGAGTACGAACTGCTGCTCACCAATCGTTGGATTCTGCAACCGTTGGCTGAGATCGAGCTCTTTGGTAAGGACGATCCCGCGCGTGGCATCGGG...TCAGGCCTGAGCACTGCAGAGCTGGGCCTGCGGTTGCGGTATGAATTTACCCGCCAGTTCGCACCGTATATAGGCCTCGTCTACGAACGCGCATTCGGCAATACAGCCGATCTTCGCCGAGACGAATCCGAGCGTGTTGACGACACACGAATCGTCGTCGGCATCCGCACCTGGTTC
TRN  10010101100011000
NAM  PCOB_ECOLI/52-296
ASQ  TSMEPIVTESRTPIPPVTDADR----------KAAFGNLQGHAI--HDSAINYLVLLDQLEWQRSDNTNNFSWSVNSWIGGDTDRIWLKSEGERSNGE-TEAAEAQLLWGHAVGPWWDLVAGVRQD-FRPAS-ARTWAAVGFQGLALYNFESEITGFVSNGGKAALRLGGEYDVLLTNRLILQPSYEVNFYSQDDESRGRG.RGLTDTELGLRLRYEIRREFAPYIGVSWNQLYGKTSDMAKREGEKDHQVVFLAGARIWF
DSQ  ACGTCAATGGAGCCCATTGTAACTGAGAGCAGAACGCCAATTCCGCCTGTTACCGATGCCGACCGG------------------------------AAGGCTGCATTCGGCAATTTACAGGGGCATGCGATT------CACGACAGTGCGATTAATTATCTGGTTCTGCTGGATCAACTGGAATGGCAACGGTCGGATAACACCAACAATTTCAGCTGGAGTGTTAACAGCTGGATTGGAGGCGACACAGATCGGATTTGGCTAAAGAGTGAAGGTGAACGAAGCAATGGGGAA---ACGGAGGCGGCTGAAGCGCAGTTACTCTGGGGACATGCGGTTGGCCCATGGTGGGATTTGGTTGCGGGTGTCAGGCAGGAT---TTCAGACCTGCTTCT---GCCCGGACCTGGGCTGCTGTCGGTTTTCAGGGGCTGGCACTCTATAATTTTGAGTCTGAAATTACGGGTTTTGTCAGTAATGGCGGAAAAGCAGCCCTTCGTCTGGGAGGAGAATACGACGTTTTACTGACTAACCGGCTCATACTCCAGCCATCCTATGAGGTGAATTTCTACAGTCAGGATGATGAATCGCGGGGTCGCGGC...AGGGGACTGACTGACACAGAGCTGGGGCTCCGGCTGCGCTATGAAATACGCCGTGAGTTTGCACCCTATATAGGCGTTTCCTGGAATCAACTTTACGGGAAAACATCCGATATGGCGAAAAGAGAAGGTGAGAAAGACCATCAGGTAGTATTCCTGGCGGGAGCCAGAATCTGGTTT
TRN  10010101100011000
NAM  Q9F3S0_9BURK/206-462
ASQ  MDHGAMQMQGGSRPPDARDPDAYSDGAKLGVGQYAIGPSRSLHM--ADEHIFASVLVDRLEWTKGNESNAASYEAQAWIGNAFNKFVIKAEGEVEKGK-VPEARTELLWGHAIATYWDTQLGVRND-AGYGRPARNWLAFGVQGLAPYWFEVEATGYVGTEGRTAVRLSGEYDLLLTQRLILQPRLEASLYGKNDPEIGNRlSGLSSGAVGVRLRYEFSRQFAPYIGIERSQSFGNTANMVRASGGRSGETRFVAGIRMWF
DSQ  ATGGATCATGGCGCCATGCAGATGCAGGGTGGAAGCCGTCCGCCGGACGCCAGAGATCCAGATGCTTATTCCGACGGCGCAAAGCTCGGCGTCGGCCAATACGCGATTGGCCCCAGCCGGTCGCTGCATATG------GCGGACGAACATATCTTCGCGTCCGTTCTCGTTGATCGCCTTGAATGGACCAAAGGCAACGAAAGCAATGCGGCATCCTACGAAGCGCAGGCGTGGATTGGGAATGCGTTCAACAAGTTCGTGATCAAGGCAGAAGGCGAGGTGGAAAAGGGCAAG---GTTCCCGAAGCCCGCACCGAACTGTTGTGGGGACACGCCATTGCCACGTATTGGGACACCCAACTGGGTGTCCGGAACGAC---GCCGGCTATGGGCGCCCTGCACGCAACTGGCTTGCGTTCGGTGTGCAAGGGTTGGCGCCTTACTGGTTCGAAGTCGAGGCAACCGGCTATGTCGGCACCGAGGGACGAACCGCCGTGCGCCTTTCCGGTGAGTATGATTTGCTGCTGACCCAGAGGCTGATCTTGCAGCCCAGGTTGGAAGCCAGCCTGTACGGCAAGAACGACCCCGAAATCGGTAATCGGctcAGTGGCCTTTCCAGCGGCGCTGTCGGAGTGCGATTGCGCTATGAATTTAGCCGGCAGTTTGCGCCGTACATCGGTATCGAACGCTCGCAAAGCTTTGGCAATACCGCAAACATGGTCCGAGCCTCCGGCGGTCGCAGCGGCGAGACGCGCTTCGTCGCGGGTATTCGCATGTGGTTC
TRN  10010101100011011
NAM  Q8XS24_RALSO/91-346
ASQ  MDHGSMNMQGGSAPPDARDPDAYSNGYRLGAGPYALGDTRHLMM--ADEHRFASVLVERLEWAHGNGTNATAYDAQAWFGTSYDKLVIKAEGDIHKGR-VEEARTELLWGHAIAPFWDTQLGLRND-AGTGRPGRSWAAFGVQGLAPYWFHLEATAYVGDSGRTALRLSSEYELLLTQRLILQPRLEASFYGKRDPALEIG.SGLSSGTLGLRLRYEFSRQFAPYVGVERSQAFGGTANLIEAAGGRRGETRVVAGVRFWF
DSQ  ATGGACCACGGCAGCATGAACATGCAGGGCGGCTCGGCGCCGCCCGACGCCCGGGACCCCGATGCGTACTCCAACGGCTACCGCCTCGGCGCCGGCCCCTACGCGCTGGGCGACACGCGCCACCTGATGATG------GCCGACGAGCACCGGTTCGCTTCGGTACTGGTGGAGCGCCTGGAATGGGCGCACGGCAACGGCACGAACGCGACCGCGTACGACGCCCAGGCCTGGTTCGGCACGAGCTACGACAAGCTGGTCATCAAGGCCGAGGGCGACATTCACAAAGGCCGT---GTCGAAGAGGCCCGCACCGAGCTGCTGTGGGGCCACGCGATCGCGCCGTTCTGGGACACCCAGCTCGGCCTGCGCAACGAT---GCGGGCACCGGCCGCCCGGGCCGCAGCTGGGCCGCGTTCGGGGTGCAGGGACTGGCGCCGTACTGGTTCCACCTCGAGGCGACGGCCTATGTCGGCGACAGCGGTCGCACCGCGCTGCGGCTCTCCAGCGAGTACGAACTGCTGCTGACACAGCGGCTCATCCTGCAGCCCCGGCTGGAGGCCAGCTTCTACGGCAAGCGCGACCCGGCCCTGGAGATCGGC...AGCGGGCTCTCCAGCGGCACGCTCGGACTGCGCCTGCGCTACGAATTCAGCCGCCAGTTCGCGCCCTATGTCGGCGTCGAGCGCAGCCAGGCGTTCGGCGGCACCGCCAACCTGATCGAGGCGGCGGGCGGACGCCGCGGCGAGACACGGGTTGTCGCGGGCGTACGCTTCTGGTTC
TRN  11011101101011011
NAM  Q9A9L5_CAUCR/66-302
ASQ  PHAGHHMHHAPPPIPTDHAAER-------FYSPAVMAAARAQLMKEHGGGTAWIVRADVAEQRFRKGDDAQAFEGQAWWGTDASKWVVKARGERVDGHGWEKAELEGLKAWPIGPYFDLQAGLRYD-LAPK--GRSYAAVGFEGLAPYWFELHGAAYVSDRGDVSARAEASYDLRLTQRLILQPRLEADL-----AEAGAG.----RLEGGLRLRYEIKREFAPYVGVVRERAFGP----AREAGERAGATAVVIGVSAWR
DSQ  CCGCACGCCGGCCATCACATGCATCACGCGCCGCCACCGATCCCCACCGACCACGCCGCCGAGCGC---------------------TTCTACAGCCCGGCCGTGATGGCCGCGGCCCGCGCCCAGCTGATGAAGGAGCACGGCGGCGGAACGGCCTGGATCGTCCGCGCCGACGTGGCCGAGCAGCGCTTCCGCAAGGGCGACGACGCCCAGGCCTTCGAAGGCCAGGCCTGGTGGGGGACTGACGCCAGCAAGTGGGTGGTCAAGGCACGCGGCGAGCGTGTCGACGGCCACGGCTGGGAGAAGGCTGAGCTGGAGGGCCTGAAGGCCTGGCCGATCGGTCCCTATTTCGACCTGCAGGCGGGGTTGCGCTACGAC---CTGGCGCCCAAG------GGGCGCAGCTACGCCGCCGTCGGCTTCGAGGGGCTGGCGCCCTATTGGTTCGAGCTGCATGGCGCGGCCTATGTCTCGGATCGCGGCGACGTCTCGGCCCGGGCCGAGGCGTCCTATGATCTGCGCCTGACCCAGAGGCTGATCCTGCAACCGCGCCTGGAGGCCGATCTG---------------GCCGAGGCCGGGGCAGGG...------------CGGCTCGAGGGCGGCCTGCGCCTGCGCTACGAGATCAAGCGCGAGTTCGCGCCCTATGTCGGCGTGGTGCGCGAGCGGGCGTTCGGCCCC------------GCGCGGGAGGCCGGCGAGCGCGCCGGGGCGACGGCGGTGGTGATCGGCGTCAGCGCCTGGCGG
TRN  10010101100011011
NAM  Q9L913_9GAMM/31-284
ASQ  PVSGYHPDLTATVEAQPRDPHEYSDGLTLSSGPSLFEGREKLSL--ADEHVFSSMLVDRLEYSSGREENYANYKALAWIGKDYQKIWFKSDGEY-KNS-LQETENQILYGYAISSYWDVLMGARYDTYKARV-IRDGLHLVFRGFAPYWFELDSSLFVDSHGLALLSLEAEYDLLLTQKLI-QPQVSVNIYSKDDSDMSVG.RGVSDLSAGLRLRYEINRQFAPYIGVEWKTLAGGTYDIAKDNEESTSDTRFITGARFWF
DSQ  CCTGTGAGTGGCTATCACCCTGATTTAACAGCAACAGTAGAGGCCCAACCAAGAGATCCCCATGAGTATTCAGATGGTCTCACACTTAGTTCTGGGCCAAGTCTATTCGAAGGAAGGGAGAAACTGTCCTTA------GCAGATGAACATGTATTTTCTTCCATGCTAGTCGATAGACTTGAATACTCTAGCGGTCGTGAAGAAAACTATGCAAATTATAAGGCACTGGCTTGGATAGGAAAAGACTATCAAAAGATATGGTTTAAATCTGATGGCGAATAT---AAAAATTCA---CTACAGGAGACAGAAAATCAAATTCTTTATGGGTATGCAATTTCGTCATACTGGGACGTCCTTATGGGGGCTAGATATGATACGTATAAAGCTAGAGTG---ATAAGGGATGGCTTGCACTTGGTATTCAGGGGCTTTGCACCATATTGGTTTGAGCTTGACTCATCATTATTTGTAGATTCTCATGGCTTGGCGCTTTTGAGCCTAGAAGCTGAATATGACCTTTTGCTTACACAGAAGTTAATA---CAGCCACAAGTTTCAGTAAATATTTACAGTAAAGATGATAGTGATATGTCAGTTGGG...CGAGGAGTGTCTGATCTAAGTGCTGGTTTACGGTTGCGTTATGAAATAAATAGACAGTTTGCACCGTATATAGGGGTTGAATGGAAAACTCTTGCTGGCGGCACATATGATATAGCTAAAGACAATGAAGAGAGTACATCTGATACTAGATTTATTACCGGTGCCAGATTCTGGTTC
TRN  10010101100011000
//