EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05251 - UPF0197)
FAM  PF05251
PID  UPF0197
DES  Uncharacterised protein family (UPF0197)
IPR  IPR007915
ANO  3
ALN  79
AID  0.576167
APH  (U197_DROME/1-78:0.31494,CK010_MOUSE/3-79:0.10896,U197_CAEEL/3-79:0.66350);
ATP  (U197_DROME/1-78,CK010_MOUSE/3-79,U197_CAEEL/3-79);
ATL  1.0874
DNO  3
DLN  237
DID  0.570555
DPH  (U197_DROME/1-78:0.37204,CK010_MOUSE/3-79:0.20343,U197_CAEEL/3-79:0.42688);
DTP  (U197_DROME/1-78,CK010_MOUSE/3-79,U197_CAEEL/3-79);
DTL  1.00235
RID  0.576167
RPH  (U197_DROME/1-78:0.31494,CK010_MOUSE/3-79:0.10896,U197_CAEEL/3-79:0.66350);
RTP  (U197_DROME/1-78,CK010_MOUSE/3-79,U197_CAEEL/3-79);
RTL  1.0874
LNK  CK010_MOUSE/3-79:P61166:AK007351
LNK  U197_CAEEL/3-79:Q965T1:AC024833
LNK  U197_DROME/1-78:Q9VVA8:AE003526
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  U197_DROME/1-78
ASQ  MDVMQRYVSPVNPAVFPHLATVLLVIGTFFTAWFFIFVVSRKSSKES-TLIKELLISLCASIFLGFGIVFLLLTVGIYV
DSQ  ATGGACGTAATGCAGCGCTACGTATCGCCCGTGAACCCGGCCGTTTTTCCCCACCTCGCCACCGTGCTTTTGGTCATCGGAACCTTCTTCACCGCCTGGTTCTTCATCTTTGTGGTGTCTCGAAAGAGCTCTAAGGAAAGC---ACCTTGATAAAGGAACTGCTGATTAGCCTGTGCGCCTCCATTTTCCTGGGATTCGGCATTGTTTTCCTGCTTCTAACCGTCGGTATTTACGTA
TRN  10010111100111011
NAM  CK010_MOUSE/3-79
ASQ  LEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVT--STKYTRDIYKELLISLVASLFMGFGVLFLLLWVGIYV
DSQ  CTCGAAGCCATGAGTAGGTACACCAGCCCAGTGAACCCGGCTGTCTTCCCTCACCTGACTGTGGTACTTCTGGCCATCGGCATGTTCTTCACTGCCTGGTTCTTCGTTTACGAGGTCACC------TCTACCAAGTACACACGCGATATTTACAAAGAGCTCCTCATCTCCTTGGTGGCCTCACTCTTCATGGGCTTTGGAGTCCTCTTCCTCCTGCTCTGGGTTGGCATCTACGTA
TRN  10010101100011001
NAM  U197_CAEEL/3-79
ASQ  ISKMNRYTAPVNFASLPLLTTFLCGVGLLLLATFTMIQVT--STKYNRNLLKELFIAATSSVFLGFGSVFLLLWVGIYV
DSQ  ATTTCCAAGATGAACAGATACACCGCTCCAGTAAACTTCGCGAGCCTTCCACTGCTCACCACGTTTCTCTGTGGAGTTGGTCTTCTTCTGCTCGCCACGTTCACCATGATCCAGGTTACA------TCGACGAAATACAACCGTAACCTTCTGAAGGAACTCTTCATCGCCGCCACATCATCAGTCTTCCTTGGCTTCGGATCGGTCTTCCTTCTTCTCTGGGTTGGAATCTACGTT
TRN  10010101100011001
//