EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05216 - UNC-50)
FAM  PF05216
PID  UNC-50
DES  UNC-50 family
IPR  IPR007881
ANO  6
ALN  246
AID  0.404377
APH  ((YRT2_CAEEL/61-287:0.42507,(Q9SKL4_ARATH/18-235:0.71715,(P87155_SCHPO/1-232:0.54654,YK10_YEAST/35-273:0.79846):0.12748):0.20829):0.13771,Q9VHN5_DROME/45-272:0.35020,Q9UQF4_HUMAN/28-256:0.31235);
ATP  ((YRT2_CAEEL/61-287,(Q9SKL4_ARATH/18-235,(P87155_SCHPO/1-232,YK10_YEAST/35-273))),Q9VHN5_DROME/45-272,Q9UQF4_HUMAN/28-256);
ATL  3.62325
DNO  6
DLN  738
DID  0.494059
DPH  ((((Q9VHN5_DROME/45-272:0.27455,YRT2_CAEEL/61-287:0.32719):0.11681,Q9UQF4_HUMAN/28-256:0.28884):0.10533,Q9SKL4_ARATH/18-235:0.49836):0.18101,P87155_SCHPO/1-232:0.43901,YK10_YEAST/35-273:0.49090);
DTP  ((((Q9VHN5_DROME/45-272,YRT2_CAEEL/61-287),Q9UQF4_HUMAN/28-256),Q9SKL4_ARATH/18-235),P87155_SCHPO/1-232,YK10_YEAST/35-273);
DTL  2.722
RID  0.404377
RPH  ((YRT2_CAEEL/61-287:0.42507,(Q9SKL4_ARATH/18-235:0.71715,(P87155_SCHPO/1-232:0.54654,YK10_YEAST/35-273:0.79846):0.12748):0.20829):0.13771,Q9VHN5_DROME/45-272:0.35020,Q9UQF4_HUMAN/28-256:0.31235);
RTP  ((YRT2_CAEEL/61-287,(Q9SKL4_ARATH/18-235,(P87155_SCHPO/1-232,YK10_YEAST/35-273))),Q9VHN5_DROME/45-272,Q9UQF4_HUMAN/28-256);
RTL  3.62325
LNK  P87155_SCHPO/1-232:P87155:Z95397
LNK  Q9SKL4_ARATH/18-235:Q9SKL4:AC006298
LNK  Q9UQF4_HUMAN/28-256:Q9UQF4:AF077038
LNK  Q9VHN5_DROME/45-272:Q9VHN5:AE003680
LNK  YK10_YEAST/35-273:P36125:Z28255
LNK  YRT2_CAEEL/61-287:Q10045:Z48055
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  YK10_YEAST/35-273
ASQ  QQSVPMVIRRLFKTPKNLDLETASWEMFHLIFHPRKAYRSIYYQRQTKNQWARDDPSFFIFQIALISLSSIIWSIYNSGFNNDSDMGALSIIGHFFKSLVMMVILDFFIFGFIMATIFYLLLNRSHFKF----KSSQNSVVEWAYCFDVHCNSFLIILLCLYFIQFLLLP-IINLQNWISLLIGNSLYCFAIGHYFILTFYGYNQLPFLKNLNFILLPTLGLSIIYLISL-FGIDLSKKL-SFYNY
DSQ  CAGCAATCTGTGCCGATGGTAATCAGGAGGCTTTTCAAAACGCCAAAGAATTTAGATCTCGAGACAGCCAGCTGGGAAATGTTCCATTTGATTTTCCATCCAAGAAAAGCTTATAGATCAATATATTATCAGCGACAGACGAAAAATCAGTGGGCGAGAGATGATCCTTCCTTTTTCATCTTCCAAATAGCCTTAATTTCACTCAGTTCTATTATTTGGTCGATTTATAATTCAGGTTTCAACAACGACAGTGATATGGGGGCCTTGAGCATTATAGGTCATTTTTTCAAAAGTTTGGTAATGATGGTGATTTTAGATTTTTTCATATTTGGATTTATTATGGCAACTATTTTTTACCTTTTGTTGAATAGGTCACATTTTAAATTC------------AAATCGAGCCAAAATAGTGTGGTAGAGTGGGCTTATTGTTTCGACGTTCATTGTAATTCATTTTTAATCATCCTACTGTGCCTATACTTCATTCAGTTTTTACTACTGCCC---ATAATTAATTTACAAAACTGGATTTCCTTACTCATTGGTAATTCGTTATATTGTTTTGCTATTGGCCATTACTTTATTTTAACCTTTTATGGATACAACCAGTTGCCATTCTTGAAAAATTTGAACTTTATACTTTTACCAACATTAGGATTATCGATAATCTATTTAATCAGTTTA---TTTGGCATCGACTTATCCAAGAAATTA---AGCTTTTACAATTAT
TRN  10010101100011000
NAM  Q9VHN5_DROME/45-272
ASQ  TTKSYKYLRRLLKF-NQMDFEFALWQMLYLFVAPQKVYRNFNYRKQTKSQFARDDPAFLVLLVVCLCVTSLGF-------AYVLGLSFWQ----SISFIFYVVFVDCIFVGIIIASFFWAVTNRYL-RT-----NSLEPDIEWGYAFDVHLNAFFPPLMLLHFIQLFFYNWLISQTWFISRFLGNTFWLMGMGYYVYITFLGYNCIPHLKNTRIILIALPIIFLLFLVVTIIGWNATISFVNFYKY
DSQ  ACCACCAAGAGCTACAAATACCTGCGACGTCTGCTCAAGTTC---AATCAAATGGACTTCGAGTTTGCCCTGTGGCAGATGCTCTACCTCTTTGTGGCGCCCCAAAAGGTGTACCGGAACTTCAACTACCGGAAACAGACCAAGTCACAGTTCGCCCGCGACGATCCGGCCTTTCTGGTCCTCCTGGTCGTCTGCCTATGTGTCACCTCCCTGGGCTTT---------------------GCGTATGTGCTGGGACTGTCTTTCTGGCAG------------AGCATCTCGTTCATATTCTATGTGGTATTCGTGGACTGTATTTTCGTGGGCATCATAATAGCCTCGTTCTTCTGGGCGGTGACGAATCGGTATCTG---CGCACA---------------AATAGCCTGGAGCCGGATATCGAGTGGGGCTATGCCTTCGATGTCCATCTAAATGCCTTCTTTCCGCCACTGATGCTGCTGCACTTCATCCAGCTGTTCTTCTACAACTGGCTGATCAGCCAAACGTGGTTCATCTCGCGATTTCTGGGCAACACCTTTTGGTTGATGGGCATGGGCTATTATGTGTACATCACATTTCTGGGATACAATTGCATTCCCCATCTGAAAAACACCCGCATCATTCTCATCGCCCTGCCCATCATCTTTCTACTGTTTCTGGTCGTCACAATTATTGGTTGGAACGCAACGATATCCTTTGTCAATTTCTACAAGTAT
TRN  10010101100011001
NAM  Q9UQF4_HUMAN/28-256
ASQ  GAKRYKYLRRLFRF-RQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGF-------GFVLDMGFFE----TIKLLLWVVLIDCVGVGLLIATLMWFISNKYLVKR-----QSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSLALGWNFTHTLCSFYKY
DSQ  GGAGCGAAACGCTACAAATATCTGAGAAGGCTTTTCCGCTTT---CGGCAAATGGACTTTGAATTTGCTGCCTGGCAGATGCTCTACCTGTTCACATCCCCACAGAGAGTTTACAGAAATTTTCATTATCGAAAACAGACGAAGGACCAGTGGGCCAGAGATGACCCTGCTTTCTTGGTCCTGTTAAGTATCTGGCTCTGTGTGTCCACTATAGGATTT---------------------GGCTTTGTGCTGGACATGGGATTCTTTGAG------------ACAATAAAGCTTCTCCTTTGGGTTGTACTCATAGATTGTGTAGGCGTTGGTCTTCTGATAGCAACTTTAATGTGGTTCATCTCTAACAAGTATTTAGTGAAACGA---------------CAGAGCAGAGACTATGATGTGGAATGGGGCTATGCTTTTGATGTGCATCTCAATGCTTTTTATCCACTCCTGGTCATTTTGCATTTTATCCAGCTTTTTTTCATCAACCATGTTATCCTGACAGACACATTTATTGGATATTTAGTTGGAAATACCTTATGGTTGGTTGCAGTTGGCTATTATATCTATGTAACTTTCCTGGGATACAGTGCATTGCCATTTTTGAAAAATACAGTAATTCTTCTGTATCCATTTGCACCTCTGATTCTGCTCTACGGGCTTTCCCTGGCACTGGGATGGAACTTCACCCATACTCTCTGTTCTTTCTATAAGTAC
TRN  10010101100011010
NAM  YRT2_CAEEL/61-287
ASQ  FAKLSRFTRRLVHI-RQMDFEFALWQMLYLLIQPSKVYKNFIYRKRTKDQFARDDPAFLVLLALSLLFSSIFY-------AYALGLEKIG----FFTFFLWSVFVDCIGVGVVIATVLWWVSNRFL-RK------VRDQDVEWGYCFDVHLNAFFPMLILLHVIVPILYPTLIDSPAFLSILLGNTFWFLAACYYVYITFLGYTALPILHKTQYFLYPISFIFMFFVATLTGGWNISRTALNFYHS
DSQ  TTCGCCAAGCTCTCACGTTTCACACGTCGTCTCGTGCACATT---CGGCAAATGGATTTCGAGTTTGCCCTCTGGCAAATGCTCTATCTGCTCATTCAGCCATCGAAAGTCTATAAAAACTTTATTTATCGAAAACGCACCAAGGATCAATTCGCCCGTGATGACCCGGCATTCCTTGTCCTTCTCGCCCTTTCCCTTCTCTTTTCTTCAATATTCTAC---------------------GCCTACGCTCTGGGCCTTGAGAAAATCGGA------------TTTTTCACGTTTTTCCTCTGGTCTGTCTTTGTTGACTGTATCGGAGTGGGCGTGGTCATCGCTACGGTGCTCTGGTGGGTCTCGAACCGATTTCTA---CGGAAA------------------GTTCGTGACCAGGACGTCGAGTGGGGTTATTGCTTCGATGTACATCTAAACGCGTTCTTCCCGATGCTCATTTTGCTGCATGTCATCGTGCCGATTTTGTATCCAACTCTCATCGACTCGCCGGCATTCCTCTCCATCCTGCTTGGCAACACGTTCTGGTTCCTGGCCGCGTGCTACTACGTCTACATCACATTTCTCGGCTACACGGCTCTTCCGATTCTCCACAAAACTCAATACTTCCTCTATCCCATCTCGTTCATTTTCATGTTCTTTGTGGCGACACTGACCGGCGGATGGAACATTTCACGGACTGCTCTCAACTTTTATCATTCC
TRN  10010101100011001
NAM  P87155_SCHPO/1-232
ASQ  MSRSFRNGFRLLKL-SQMDFERAWWDMANLFRAPRRVYRSITLRKQNINRYGREDFSFIVLFSCMIVISALLW-------ALFYMNTPKG----YVTTITFMLFVDFGAVGVIMATMYYFIAKRFLMKSNDTILSSTDYQLEWNYCFDVHCNSFFPSFVLLYVIQLFLLP-VITRDNFISLFMGNTLYLVALCYYSYLTFIGYQILPFLKNTHALLLPIPMFFIMWALSL-LGFNVPKHVVDVYFG
DSQ  ATGAGTAGGTCATTTCGTAATGGATTCCGCTTGTTGAAGCTT---TCTCAAATGGATTTTGAACGGGCATGGTGGGATATGGCAAACTTGTTTCGCGCTCCACGTCGAGTTTATCGGTCCATTACCCTACGGAAACAAAACATCAACAGATATGGTCGAGAGGATTTTTCGTTTATCGTTCTTTTTTCATGTATGATAGTAATTAGTGCTTTGTTGTGG---------------------GCTTTGTTTTACATGAACACTCCGAAAGGA------------TATGTTACGACGATTACTTTCATGTTATTTGTAGACTTTGGAGCTGTCGGTGTGATTATGGCTACTATGTATTACTTTATTGCGAAACGATTTTTAATGAAAAGTAATGATACCATTTTAAGTTCGACAGATTATCAGCTGGAATGGAATTACTGCTTCGATGTACACTGTAATTCTTTTTTTCCTTCTTTTGTTCTTCTTTATGTGATTCAGTTGTTTTTGTTACCA---GTCATTACACGAGATAATTTCATTTCATTATTCATGGGAAATACGCTTTATTTAGTTGCTCTATGTTATTACTCATATTTAACATTTATTGGATATCAAATTCTTCCTTTCTTAAAAAATACTCACGCCCTTCTTCTTCCCATACCAATGTTTTTTATAATGTGGGCACTTTCCTTA---CTTGGATTCAACGTTCCAAAGCATGTTGTTGATGTTTATTTTGGA
TRN  10010101100011000
NAM  Q9SKL4_ARATH/18-235
ASQ  NPMFLQYFRRIVKW-QQMDVEYTFWQMLNLCTSPKVVYQHTKYHKQTKNQWARDDPAFIVICSLLLVVATVAY-------CVTYDHSSSH----AVVVVVSVLFTHFLITGAVIATCCWFLTNSYL-REETPNSHVVEQRVEWLYTFDVHCNSFFPMFVLLYVVHYFLSP-LLIAHGFIPLLLSNLLFMVGASYYHYLNFLGYDVLPFLERTTFFLYPIGVVIVLSPILI---------L-----S
DSQ  AATCCAATGTTCCTTCAGTACTTTCGTCGTATCGTTAAGTGG---CAGCAAATGGATGTTGAATATACTTTCTGGCAAATGCTTAACCTTTGTACATCTCCGAAAGTTGTCTATCAACACACTAAGTATCACAAACAAACTAAGAACCAATGGGCACGTGATGACCCTGCGTTTATTGTGATCTGTAGCCTGCTTCTTGTTGTTGCAACTGTAGCCTAT---------------------TGTGTCACGTATGACCATAGTAGCTCTCAT------------GCCGTCGTCGTAGTCGTTTCAGTTTTGTTCACCCATTTCTTAATCACCGGAGCAGTTATAGCTACATGCTGTTGGTTTTTGACAAATTCTTACCTT---CGCGAGGAGACTCCAAACAGTCATGTGGTGGAACAACGCGTTGAATGGCTGTATACATTTGATGTTCACTGCAACTCGTTCTTTCCAATGTTTGTGCTGCTCTACGTCGTACATTACTTCTTATCACCG---CTCCTGATAGCACACGGATTCATCCCTTTACTGCTATCGAATCTGCTTTTCATGGTCGGGGCTTCGTACTACCATTATCTTAACTTCCTAGGATATGACGTGCTTCCATTTTTGGAGCGAACAACATTCTTCCTCTACCCAATCGGAGTTGTCATTGTCCTGTCTCCTATTCTTATC---------------------------TTA---------------AGC
TRN  10010101100011000
//