EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05182 - Fip1)
FAM  PF05182
PID  Fip1
DES  Fip1 motif
IPR  IPR007854
ANO  8
ALN  64
AID  0.40281
APH  (Q9VN31_DROME/218-280:0.27021,((FIP1_YEAST/178-238:0.78783,YAAA_SCHPO/119-178:0.17652):0.35251,(Q99LH0_MOUSE/152-211:0.12057,(Q9C834_ARATH/158-221:0.59988,Q9FGU0_ARATH/336-398:0.38721):0.42836):0.16291):0.16394,(Q9BHY5_LEIMA/63-123:0.78697,O16293_CAEEL/133-193:0.34181):0.29268);
ATP  (Q9VN31_DROME/218-280,((FIP1_YEAST/178-238,YAAA_SCHPO/119-178),(Q99LH0_MOUSE/152-211,(Q9C834_ARATH/158-221,Q9FGU0_ARATH/336-398))),(Q9BHY5_LEIMA/63-123,O16293_CAEEL/133-193));
ATL  4.8714
DNO  8
DLN  192
DID  0.498867
DPH  ((((Q9VN31_DROME/218-280:0.25685,(Q9BHY5_LEIMA/63-123:0.50515,O16293_CAEEL/133-193:0.27281):0.16708):0.16661,(Q99LH0_MOUSE/152-211:0.12168,YAAA_SCHPO/119-178:0.36080):0.12387):0.17381,Q9FGU0_ARATH/336-398:0.34251):0.13315,Q9C834_ARATH/158-221:0.26770,FIP1_YEAST/178-238:0.69619);
DTP  ((((Q9VN31_DROME/218-280,(Q9BHY5_LEIMA/63-123,O16293_CAEEL/133-193)),(Q99LH0_MOUSE/152-211,YAAA_SCHPO/119-178)),Q9FGU0_ARATH/336-398),Q9C834_ARATH/158-221,FIP1_YEAST/178-238);
DTL  3.5767
RID  0.40281
RPH  (Q9VN31_DROME/218-280:0.27021,((FIP1_YEAST/178-238:0.78783,YAAA_SCHPO/119-178:0.17652):0.35251,(Q99LH0_MOUSE/152-211:0.12057,(Q9C834_ARATH/158-221:0.59988,Q9FGU0_ARATH/336-398:0.38721):0.42836):0.16291):0.16394,(Q9BHY5_LEIMA/63-123:0.78697,O16293_CAEEL/133-193:0.34181):0.29268);
RTP  (Q9VN31_DROME/218-280,((FIP1_YEAST/178-238,YAAA_SCHPO/119-178),(Q99LH0_MOUSE/152-211,(Q9C834_ARATH/158-221,Q9FGU0_ARATH/336-398))),(Q9BHY5_LEIMA/63-123,O16293_CAEEL/133-193));
RTL  4.8714
LNK  FIP1_YEAST/178-238:P45976:X83796
LNK  O16293_CAEEL/133-193:O16293:AF016427
LNK  Q99LH0_MOUSE/152-211:Q99LH0:BC003263
LNK  Q9BHY5_LEIMA/63-123:Q9BHY5:AL583932
LNK  Q9C834_ARATH/158-221:Q9C834:AC036106
LNK  Q9FGU0_ARATH/336-398:Q9FGU0:AB024029
LNK  Q9VN31_DROME/218-280:Q9VN31:AE003606
LNK  YAAA_SCHPO/119-178:Q09801:Z54328
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9FGU0_ARATH/336-398
ASQ  FEVDIDSFEEKPWRYPGVEMTDYFNFGLNEESWKDYCKQLDQHR-IQTTMQSRIRVYESGRTDQ
DSQ  TTTGAGGTCGACATAGATAGTTTTGAAGAAAAGCCCTGGAGATATCCAGGAGTTGAGATGACAGACTACTTCAACTTTGGACTAAATGAGGAGAGCTGGAAAGACTATTGCAAACAGCTGGACCAACACCGT---ATACAGACTACGATGCAAAGCAGAATACGTGTTTATGAAAGCGGTAGAACGGATCAG
TRN  10010101100011011
NAM  Q9C834_ARATH/158-221
ASQ  FDVNLDVLEKKPWRDPGTDTSDFFNFGLNEQSWKDYCKPLGRAIEVRGGTLERIPSADLRRPRD
DSQ  TTTGATGTAAATCTCGATGTGTTAGAGAAGAAGCCATGGAGGGATCCTGGTACGGATACCAGTGACTTTTTTAATTTTGGGCTTAACGAGCAGAGCTGGAAAGATTACTGTAAACCGTTGGGAAGAGCAATTGAGGTTAGAGGTGGTACTCTTGAGCGAATACCTTCTGCAGATTTGCGTCGTCCACGTGAT
TRN  10010101110011010
NAM  YAAA_SCHPO/119-178
ASQ  FEIDLESFDDKPWRKPGADISDYFNYGFDEFTWAAYCAKQTT---LRDD-FSPQKFMASLAQIP
DSQ  TTTGAGATTGATTTGGAGTCTTTTGATGATAAACCATGGCGCAAGCCTGGTGCAGATATCTCAGATTATTTTAACTATGGATTTGATGAATTTACATGGGCTGCTTACTGTGCCAAACAAACGACT---------TTGCGTGACGAC---TTTAGCCCCCAAAAATTTATGGCAAGTCTTGCTCAGATCCCG
TRN  11011101111011001
NAM  Q9VN31_DROME/218-280
ASQ  HEFSIDSLEEKPWRKPGADITDYFNYGFNEETWRAYCERQKRFRVAESG-VGLASLTQNVNQNA
DSQ  CACGAGTTCAGTATCGATTCGCTTGAGGAGAAGCCGTGGCGAAAGCCGGGAGCGGATATTACCGACTACTTCAACTATGGCTTTAACGAAGAGACGTGGCGCGCCTATTGCGAGCGCCAGAAACGCTTCCGCGTGGCGGAGAGTGGT---GTCGGACTGGCCAGCCTCACTCAGAATGTGAATCAGAATGCC
TRN  11011101101011011
NAM  Q99LH0_MOUSE/152-211
ASQ  LEVDLDSFEDKPWRKPGADLSDYFNYGFNEDTWKAYCEKQKR---IRMG-LEVIPVTSTTNKIT
DSQ  TTGGAAGTAGATCTGGATTCTTTTGAAGATAAACCATGGCGGAAACCTGGTGCTGATCTTTCTGATTATTTTAACTATGGCTTTAATGAAGATACTTGGAAAGCTTACTGTGAAAAACAAAAGAGG---------ATACGAATGGGA---CTGGAAGTTATACCTGTTACTTCAACCACAAACAAGATTACG
TRN  10010101100011001
NAM  O16293_CAEEL/133-193
ASQ  YDLDLAQMEDRPWRKPGADITDYFNYGFTEETWNLYCERQKK---LRIEFAGNQKAANEALFSS
DSQ  TATGATCTTGATCTGGCGCAGATGGAAGATCGACCATGGCGAAAACCTGGAGCAGATATCACGGATTATTTCAACTATGGTTTCACCGAAGAGACATGGAATCTTTACTGCGAGCGACAGAAGAAG---------TTGAGAATCGAATTCGCCGGAAACCAGAAAGCTGCAAACGAAGCGTTGTTCTCTTCC
TRN  10010101100011011
NAM  FIP1_YEAST/178-238
ASQ  TTIDPEVLKEKPWRQPGANLSDYFNYGFNEFTWMEYLHRQEK---LQQDYNPRRILMGLLSLQQ
DSQ  ACGACAATAGATCCTGAAGTATTAAAGGAGAAACCCTGGAGGCAACCGGGGGCCAACTTAAGTGATTATTTCAATTACGGTTTTAACGAATTTACCTGGATGGAGTATTTACATAGACAGGAAAAA---------CTACAACAAGATTATAATCCTAGGAGGATCCTAATGGGCCTATTATCCCTCCAACAG
TRN  10010101110011010
NAM  Q9BHY5_LEIMA/63-123
ASQ  FGYDIALMAKRPWAEPGAKLSDYFNYGFNEQSWRVYCAMQEK---GEESLLANATAVLQKLELA
DSQ  TTCGGCTACGACATCGCGCTGATGGCGAAGCGGCCGTGGGCCGAGCCTGGCGCGAAGCTGAGCGACTACTTCAACTATGGCTTCAACGAACAGAGCTGGCGCGTGTACTGTGCTATGCAGGAGAAG---------GGCGAAGAGTCACTGCTGGCCAACGCCACAGCAGTGTTGCAGAAGTTGGAGCTGGCG
TRN  11011111101111101
//