EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05166 - DUF709)
FAM  PF05166
PID  DUF709
DES  Family of unknown function (DUF709)
IPR  IPR007840
ANO  5
ALN  82
AID  0.466781
APH  (((YCGL_ECOLI/13-94:0.41483,Q9KQP1_VIBCH/12-92:0.27972):0.14626,Q9I449_PSEAE/4-85:0.66263):0.28474,Q9CNI7_PASMU/2-83:0.29173,YCGL_HAEIN/21-102:0.38848);
ATP  (((YCGL_ECOLI/13-94,Q9KQP1_VIBCH/12-92),Q9I449_PSEAE/4-85),Q9CNI7_PASMU/2-83,YCGL_HAEIN/21-102);
ATL  2.4684
DNO  5
DLN  246
DID  0.522523
DPH  ((Q9KQP1_VIBCH/12-92:0.23396,Q9I449_PSEAE/4-85:0.57798):0.12625,(YCGL_HAEIN/21-102:0.28703,Q9CNI7_PASMU/2-83:0.24711):0.25719,YCGL_ECOLI/13-94:0.25579);
DTP  ((Q9KQP1_VIBCH/12-92,Q9I449_PSEAE/4-85),(YCGL_HAEIN/21-102,Q9CNI7_PASMU/2-83),YCGL_ECOLI/13-94);
DTL  1.98531
RID  0.466781
RPH  (((YCGL_ECOLI/13-94:0.41483,Q9KQP1_VIBCH/12-92:0.27972):0.14626,Q9I449_PSEAE/4-85:0.66263):0.28474,Q9CNI7_PASMU/2-83:0.29173,YCGL_HAEIN/21-102:0.38848);
RTP  (((YCGL_ECOLI/13-94,Q9KQP1_VIBCH/12-92),Q9I449_PSEAE/4-85),Q9CNI7_PASMU/2-83,YCGL_HAEIN/21-102);
RTL  2.4684
LNK  Q9CNI7_PASMU/2-83:Q9CNI7:AE006080
LNK  Q9I449_PSEAE/4-85:Q9I449:AE004559
LNK  Q9KQP1_VIBCH/12-92:Q9KQP1:AE004271
LNK  YCGL_ECOLI/13-94:P76003:U00096
LNK  YCGL_HAEIN/21-102:P44198:U32823
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  YCGL_ECOLI/13-94
ASQ  FCVIYRSSKRDQTYLYVEKKDDFSRVPEELMKGFGQPQLAMILPLDGRKKLVNADIEKVKQALTEQGYYLQLPPPPEDLLKQ
DSQ  TTTTGTGTGATTTATCGAAGCAGCAAGCGTGACCAGACCTATTTATATGTCGAAAAAAAAGACGATTTTTCGCGTGTTCCTGAGGAACTGATGAAAGGTTTTGGTCAGCCTCAGTTAGCGATGATTCTGCCGCTGGATGGGCGGAAGAAACTGGTCAATGCCGATATTGAAAAGGTTAAACAGGCATTAACCGAGCAAGGTTACTATTTGCAGTTACCGCCACCACCCGAAGATTTGCTGAAGCAA
TRN  11011101101011010
NAM  Q9KQP1_VIBCH/12-92
ASQ  LCSIYKSPKKEGTYLYIPKRDDFSQVPDTLKQMFGKPIFVMLVNLE-QRRLAQVNVEKVKQSMQEQGFFLQLPPPPENLLEQ
DSQ  CTTTGCTCTATTTACAAAAGTCCTAAAAAAGAAGGCACTTATCTCTATATTCCGAAACGGGACGATTTTTCACAGGTCCCTGACACCTTAAAACAGATGTTTGGTAAACCTATTTTTGTCATGCTGGTCAATCTTGAG---CAGCGTCGGTTGGCGCAAGTGAATGTGGAGAAGGTGAAACAATCCATGCAGGAACAAGGTTTCTTTTTGCAGTTACCGCCGCCACCAGAAAATTTGCTGGAACAA
TRN  11011101101011000
NAM  YCGL_HAEIN/21-102
ASQ  LCAIYKSKKKLGSYLYVANREDFSSVPSVLLEHFGKPELVMMFNLLGRKALHNVDCNEVLETIKRQGFYLQIAKQDDGLFNS
DSQ  CTATGTGCCATTTATAAAAGTAAAAAGAAGTTAGGAAGTTACCTTTATGTTGCCAATAGAGAGGATTTTTCTTCAGTGCCCAGCGTTTTACTCGAACATTTTGGTAAACCAGAATTAGTGATGATGTTTAATCTGCTTGGGCGTAAAGCACTACACAATGTAGATTGTAATGAAGTATTGGAAACAATTAAACGCCAAGGATTTTACTTACAAATAGCAAAACAAGATGATGGTTTATTTAATAGC
TRN  10010101100011000
NAM  Q9CNI7_PASMU/2-83
ASQ  LCAIYKSTRKMGTYLYVAKRDQFDVVPEVLRNAFGPPVFVMMFNLAGEKALVNAEKAEVRKQIETQGFYLQMPKEDDWLFKL
DSQ  TTATGTGCGATTTATAAAAGTACAAGAAAAATGGGGACATATCTTTATGTGGCAAAACGTGATCAATTTGATGTGGTTCCTGAGGTATTAAGAAATGCTTTTGGTCCCCCTGTTTTTGTGATGATGTTTAATCTCGCTGGCGAGAAAGCATTAGTTAATGCGGAGAAAGCCGAAGTCCGTAAACAAATTGAAACACAAGGTTTTTATTTACAAATGCCAAAAGAGGATGACTGGCTATTTAAGTTG
TRN  10010101110011010
NAM  Q9I449_PSEAE/4-85
ASQ  ICSVYKSPRKSEMYLYVDKREALSRVPEALLVPFGAPQHVFDLLLTPERQLAREDVAKVLENIEKQGFHLQMPPGEEEYIEH
DSQ  ATCTGTTCCGTCTACAAGAGCCCGCGCAAGAGCGAGATGTACCTCTATGTCGACAAGCGCGAGGCGTTGAGCCGCGTGCCCGAGGCCCTGCTGGTGCCGTTCGGCGCGCCGCAACATGTCTTCGACCTGCTGCTCACCCCCGAGCGCCAACTGGCCCGCGAGGATGTCGCCAAGGTCCTGGAGAACATCGAGAAGCAGGGCTTCCACTTGCAGATGCCGCCGGGCGAAGAAGAGTACATCGAGCAT
TRN  11011111101111111
//