EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05130 - FlgN)
FAM  PF05130
PID  FlgN
DES  FlgN protein
IPR  IPR007809
ANO  4
ALN  160
AID  0.199557
APH  (Q9KQ02_VIBCH/1-143:1.21188,Q9HYP4_PSEAE/1-156:1.10544,(FLGN_BUCAI/1-135:1.79949,FLGN_ECOLI/1-138:0.40904):0.85047);
ATP  (Q9KQ02_VIBCH/1-143,Q9HYP4_PSEAE/1-156,(FLGN_BUCAI/1-135,FLGN_ECOLI/1-138));
ATL  5.37632
DNO  4
DLN  480
DID  0.35529
DPH  (Q9KQ02_VIBCH/1-143:12.72563,Q9HYP4_PSEAE/1-156:9.22961,(FLGN_BUCAI/1-135:7.66363,FLGN_ECOLI/1-138:7.86068):2.99452);
DTP  (Q9KQ02_VIBCH/1-143,Q9HYP4_PSEAE/1-156,(FLGN_BUCAI/1-135,FLGN_ECOLI/1-138));
DTL  3.10696
RID  0.199557
RPH  (Q9KQ02_VIBCH/1-143:1.21188,Q9HYP4_PSEAE/1-156:1.10544,(FLGN_BUCAI/1-135:1.79949,FLGN_ECOLI/1-138:0.40904):0.85047);
RTP  (Q9KQ02_VIBCH/1-143,Q9HYP4_PSEAE/1-156,(FLGN_BUCAI/1-135,FLGN_ECOLI/1-138));
RTL  5.37632
LNK  FLGN_BUCAI/1-135:P57417:AP001119
LNK  FLGN_ECOLI/1-138:P43533:U00096
LNK  Q9HYP4_PSEAE/1-156:Q9HYP4:AE004757
LNK  Q9KQ02_VIBCH/1-143:Q9KQ02:AE004292
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9KQ02_VIBCH/1-143
ASQ  MA-MAALKDLVEFQLKNAQELVTVLEAEKVAITSRISV--DIESIAKQKLTLVNQLQQTDQRIAKHPHVASL--------------TEDTYLNELVSQIRSIIMDCQQANLINGDALARAQLSFNKLNNLMQQSHGKIGMTYSATGKTHTISTLGTNIKA
DSQ  TTGGCG---ATGGCAGCATTAAAAGACTTGGTTGAGTTTCAACTGAAAAATGCGCAAGAACTCGTGACCGTACTCGAAGCGGAGAAAGTTGCGATCACCAGCCGAATCTCTGTC------GATATCGAATCCATTGCTAAACAGAAACTCACCTTAGTCAATCAATTACAGCAAACTGACCAACGCATTGCGAAACATCCGCATGTCGCGAGCCTG------------------------------------------ACTGAAGATACTTATCTCAATGAGTTGGTGAGTCAAATCCGCAGTATTATCATGGATTGCCAGCAAGCCAACCTGATTAATGGCGATGCTTTGGCCCGCGCGCAATTGAGCTTCAATAAACTCAATAACCTGATGCAACAAAGTCATGGCAAGATTGGTATGACTTACAGCGCGACCGGGAAAACCCATACTATTTCAACCTTGGGTACCAATATCAAAGCA
TRN  11011101101011000
NAM  Q9HYP4_PSEAE/1-156
ASQ  MPDSPTLLDLFAEDIGHANQLLQLVDEEFQALERRELP--VLQQLLGAKQPLMQQLERNGRARAEILREAGVSLDREGLARYARERADGAELLARGDELGELLERCQQANLRNGRIIRANQASTGSLLNILRGQDAPS--LYDSRGGTASSSRQRPLSQA
DSQ  ATGCCTGACTCCCCTACCCTGCTCGATCTGTTCGCCGAGGATATCGGCCACGCCAACCAACTCCTGCAGTTGGTCGACGAAGAATTCCAGGCCCTGGAACGGCGCGAGCTGCCG------GTTCTGCAACAGCTTCTCGGGGCCAAGCAGCCACTGATGCAGCAACTGGAGCGAAATGGCCGGGCCCGCGCGGAAATCCTCCGCGAAGCCGGCGTTTCCCTCGACCGCGAAGGCCTTGCCCGCTATGCCCGCGAGCGCGCGGATGGCGCCGAGCTGCTGGCGCGCGGCGACGAACTGGGCGAACTGCTGGAGCGTTGCCAGCAGGCCAATCTGCGCAACGGGCGGATCATCCGCGCCAACCAGGCTTCCACCGGCAGCCTGCTGAACATCCTCCGCGGCCAGGACGCCCCGAGC------CTGTACGACAGCCGCGGCGGCACCGCCTCGAGCAGCCGGCAACGTCCGCTCAGCCAGGCC
TRN  11011111101111111
NAM  FLGN_ECOLI/1-138
ASQ  MT---RLAEILDQMSAVLNDLKTVMDQEQQHLSMGQINGSQLQWITEQKSSLLATLDYLEQLRRKEPNT-----------------ANSVDISQRWQEITVKTQQLRQMNQHNGWLLEGQIERNQQALEMLKPHQEPT--LYGANGQTSTTHRGGKKISI
DSQ  ATGACA---------CGTCTTGCAGAGATCCTCGACCAGATGTCCGCTGTGCTTAACGATCTCAAAACGGTAATGGATCAAGAGCAGCAACATCTCTCTATGGGGCAGATCAACGGCAGCCAGTTGCAATGGATTACAGAACAAAAAAGCTCACTGCTGGCGACGCTGGATTACCTCGAACAGTTACGCAGGAAAGAACCCAATACA---------------------------------------------------GCAAATAGCGTTGATATTAGTCAACGCTGGCAGGAAATTACTGTGAAAACGCAGCAACTACGCCAAATGAATCAACATAACGGCTGGTTACTGGAAGGACAGATTGAGCGCAATCAACAGGCGCTGGAAATGTTGAAACCGCATCAGGAACCGACG------CTATATGGGGCGAACGGTCAGACCTCAACAACCCATCGCGGCGGTAAAAAGATTTCGATC
TRN  10010101100011000
NAM  FLGN_BUCAI/1-135
ASQ  MN---NLIDTIKKIENILYSLERILKQECHNLLKSKTSNEEILELIKRKKILFKKLIILSQDRLCLEKEYNIFPPY----------ESNNKLNNYWKKIINTCLILRKLNLKNKIIMNKKFYLNQRFLELSSSYKKSV--TYNLDG----------NLEI
DSQ  ATGAAT---------AATTTAATAGATACAATAAAAAAAATAGAAAATATTTTATATTCTTTAGAACGAATATTAAAACAAGAATGTCATAATTTATTAAAGTCTAAGACTTCTAATGAAGAAATTTTAGAATTAATCAAGAGAAAAAAAATATTGTTTAAGAAATTGATAATTTTAAGTCAAGATAGATTATGTTTAGAAAAAGAATATAATATATTTCCACCTTAT------------------------------GAAAGTAATAATAAATTAAATAATTACTGGAAAAAAATTATTAATACGTGTCTTATATTAAGAAAACTCAACCTTAAGAATAAAATTATTATGAATAAGAAATTTTATTTAAATCAGCGTTTTTTAGAATTGTCTTCATCATATAAAAAATCTGTC------ACCTATAACTTAGATGGA------------------------------AATTTAGAAATT
TRN  10010101110011000
//