EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05115 - PetL)
FAM  PF05115
PID  PetL
DES  Cytochrome B6-F complex subunit VI (PetL)
IPR  IPR007802
ANO  6
ALN  32
AID  0.55914
APH  (((PETL_PINTH/16-46:0.28125,(PETL_ARATH/1-31:0.20147,PETL_MARPO/1-31:0.23545):0.00000):0.08798,PETL_NEPOL/1-31:0.28849):0.36088,PETL_CHLRE/12-43:0.24236,PETL_CHLVU/1-31:0.31792);
ATP  (((PETL_PINTH/16-46,(PETL_ARATH/1-31,PETL_MARPO/1-31)),PETL_NEPOL/1-31),PETL_CHLRE/12-43,PETL_CHLVU/1-31);
ATL  2.01579
DNO  6
DLN  96
DID  0.617921
DPH  (PETL_PINTH/16-46:0.26070,(((PETL_CHLRE/12-43:0.19633,PETL_CHLVU/1-31:0.29514):0.18525,PETL_NEPOL/1-31:0.28728):0.11403,PETL_MARPO/1-31:0.18198):0.04441,PETL_ARATH/1-31:0.10953);
DTP  (PETL_PINTH/16-46,(((PETL_CHLRE/12-43,PETL_CHLVU/1-31),PETL_NEPOL/1-31),PETL_MARPO/1-31),PETL_ARATH/1-31);
DTL  1.67465
RID  0.55914
RPH  (((PETL_PINTH/16-46:0.28125,(PETL_ARATH/1-31:0.20147,PETL_MARPO/1-31:0.23545):0.00000):0.08798,PETL_NEPOL/1-31:0.28849):0.36088,PETL_CHLRE/12-43:0.24236,PETL_CHLVU/1-31:0.31792);
RTP  (((PETL_PINTH/16-46,(PETL_ARATH/1-31,PETL_MARPO/1-31)),PETL_NEPOL/1-31),PETL_CHLRE/12-43,PETL_CHLVU/1-31);
RTL  2.01579
LNK  PETL_ARATH/1-31:P56776:AP000423
LNK  PETL_CHLRE/12-43:P50369:U43964
LNK  PETL_CHLVU/1-31:P56306:AB001684
LNK  PETL_MARPO/1-31:P12179:X04465
LNK  PETL_NEPOL/1-31:Q9TKY9:AF137379
LNK  PETL_PINTH/16-46:P52805:D17510
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxx
NAM  PETL_PINTH/16-46
ASQ  TITIISYFGFLLASIIFTLVLFISSSK.IQLI
DSQ  ACTATAACTATAATTAGTTATTTCGGTTTCTTATTGGCTTCTATCATTTTCACCCTAGTCCTATTCATTAGTTCGAGCAAG...ATACAACTTATT
TRN  10010111110111010
NAM  PETL_MARPO/1-31
ASQ  MLTIISYFLFLIGALTLALVLFIGLNK.IQLI
DSQ  ATGCTTACAATAATTAGTTATTTTCTTTTTTTAATCGGTGCTTTAACATTAGCGTTAGTTTTATTTATTGGGTTAAATAAA...ATACAACTTATT
TRN  10010101110011010
NAM  PETL_ARATH/1-31
ASQ  MPTITSYFGFLLAALTITSVLFIGLSK.IRLI
DSQ  ATGCCTACTATAACTAGTTATTTCGGTTTTCTACTAGCAGCTTTAACTATAACCTCAGTTCTGTTTATTGGTCTAAGCAAA...ATACGACTTATT
TRN  10010101100011000
NAM  PETL_NEPOL/1-31
ASQ  MFTVISYFGFLLVALAFTLVTYLGLRA.IQLI
DSQ  ATGTTTACAGTCATTAGCTATTTTGGATTCCTTCTGGTTGCCTTAGCCTTTACCTTGGTGACATACCTTGGGTTGAGAGCG...ATCCAATTGATT
TRN  10010101100011010
NAM  PETL_CHLVU/1-31
ASQ  MVTIFSYIALLLSALVITLTCYIGLLK.IKLI
DSQ  ATGGTAACCATTTTTAGTTATATTGCTTTATTACTGAGTGCCCTAGTAATCACTTTAACTTGTTATATTGGTCTTTTAAAA...ATTAAATTAATT
TRN  11011101101011010
NAM  PETL_CHLRE/12-43
ASQ  MLTITSYVGLLIGALVFTLGIYLGLLKvVKLI
DSQ  ATGTTAACAATCACAAGTTACGTAGGTTTACTTATTGGTGCTTTAGTTTTTACTTTAGGTATTTATTTAGGTCTTTTAAAAgttGTAAAACTTATC
TRN  11011101111011010
//