EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05105 - Phage_holin_4)
FAM  PF05105
PID  Phage_holin_4
DES  Holin family
IPR  IPR006480
ANO  13
ALN  146
AID  0.239215
APH  (((YQXH_BACSU/13-135:0.18420,VLYS_BPPH1/8-130:0.12552):0.62923,((VLYS_BPCP1/1-123:1.07576,(Q46343_CLOSO/1-140:0.18459,Q9ZIB0_CLODI/20-163:0.15245):1.41409):0.18749,(Q9FZW1_BPGA1/5-133:0.73049,(VG14_BPPZA/7-130:0.00000,VG14_BPB03/8-131:0.29245):0.63755):1.62198):0.29609):0.19813,(Y965_BACHD/12-133:0.65995,((Y1842_CLOAB/9-125:0.48936,YTKC_BACSU/14-134:1.21245):0.35831,YNGD_CLOPE/15-132:0.51275):0.23455):0.00000,O21980_9CAUD/1-56:1.93565);
ATP  (((YQXH_BACSU/13-135,VLYS_BPPH1/8-130),((VLYS_BPCP1/1-123,(Q46343_CLOSO/1-140,Q9ZIB0_CLODI/20-163)),(Q9FZW1_BPGA1/5-133,(VG14_BPPZA/7-130,VG14_BPB03/8-131)))),(Y965_BACHD/12-133,((Y1842_CLOAB/9-125,YTKC_BACSU/14-134),YNGD_CLOPE/15-132)),O21980_9CAUD/1-56);
ATL  13.133
DNO  13
DLN  438
DID  0.402762
DPH  (VG14_BPPZA/7-130:0.12011,(Q9FZW1_BPGA1/5-133:0.45801,((Q9ZIB0_CLODI/20-163:0.13213,Q46343_CLOSO/1-140:0.09408):0.56135,((((Y965_BACHD/12-133:0.41401,((VLYS_BPPH1/8-130:0.17175,YQXH_BACSU/13-135:0.19294):0.40877,(O21980_9CAUD/1-56:0.66411,VLYS_BPCP1/1-123:0.72547):0.05808):0.14100):0.18382,YNGD_CLOPE/15-132:0.31249):0.11333,Y1842_CLOAB/9-125:0.40984):0.12571,YTKC_BACSU/14-134:0.70601):0.19970):0.55923):0.37770,VG14_BPB03/8-131:0.24797);
DTP  (VG14_BPPZA/7-130,(Q9FZW1_BPGA1/5-133,((Q9ZIB0_CLODI/20-163,Q46343_CLOSO/1-140),((((Y965_BACHD/12-133,((VLYS_BPPH1/8-130,YQXH_BACSU/13-135),(O21980_9CAUD/1-56,VLYS_BPCP1/1-123))),YNGD_CLOPE/15-132),Y1842_CLOAB/9-125),YTKC_BACSU/14-134))),VG14_BPB03/8-131);
DTL  7.42406
RID  0.239215
RPH  (((YQXH_BACSU/13-135:0.18420,VLYS_BPPH1/8-130:0.12552):0.62923,((VLYS_BPCP1/1-123:1.07576,(Q46343_CLOSO/1-140:0.18459,Q9ZIB0_CLODI/20-163:0.15245):1.41409):0.18749,(Q9FZW1_BPGA1/5-133:0.73049,(VG14_BPPZA/7-130:0.00000,VG14_BPB03/8-131:0.29245):0.63755):1.62198):0.29609):0.19813,(Y965_BACHD/12-133:0.65995,((Y1842_CLOAB/9-125:0.48936,YTKC_BACSU/14-134:1.21245):0.35831,YNGD_CLOPE/15-132:0.51275):0.23455):0.00000,O21980_9CAUD/1-56:1.93565);
RTP  (((YQXH_BACSU/13-135,VLYS_BPPH1/8-130),((VLYS_BPCP1/1-123,(Q46343_CLOSO/1-140,Q9ZIB0_CLODI/20-163)),(Q9FZW1_BPGA1/5-133,(VG14_BPPZA/7-130,VG14_BPB03/8-131)))),(Y965_BACHD/12-133,((Y1842_CLOAB/9-125,YTKC_BACSU/14-134),YNGD_CLOPE/15-132)),O21980_9CAUD/1-56);
RTL  13.133
LNK  O21980_9CAUD/1-56:O21980:X95646
LNK  Q46343_CLOSO/1-140:Q46343:X82638
LNK  Q9FZW1_BPGA1/5-133:Q9FZW1:X96987
LNK  Q9ZIB0_CLODI/20-163:Q9ZIB0:AF035716
LNK  VG14_BPB03/8-131:Q37895:X99260
LNK  VG14_BPPZA/7-130:P07539:M11813
LNK  VLYS_BPCP1/1-123:Q38008:Z47794
LNK  VLYS_BPPH1/8-130:Q9ZXD8:AB016282
LNK  Y1842_CLOAB/9-125:Q97I14:AE007693
LNK  Y965_BACHD/12-133:Q9KE91:AP001510
LNK  YNGD_CLOPE/15-132:P26835:M81878
LNK  YQXH_BACSU/13-135:P24811:M59232
LNK  YTKC_BACSU/14-134:O34883:AF008220
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  VG14_BPB03/8-131
ASQ  TKHVLESDDTKLIY--WLTLLMVCMIVDTILGIVIARINPKEKFSSFKMKTGILIKVSEMIIALLAVPFALPFPA--GLPLLYTVYT---------------ALCVSEMYSIFGHLRVVDDKSN---FLSIIEGFFKQTYRKDKGD
DSQ  ACAAAACACGTGTTGGAATCTGATGATACAAAGCTAATATAC------TGGTTGACGTTGTTAATGGTTTGCATGATTGTTGATACTATTCTAGGCATTGTGATTGCGAGAATCAATCCTAAAGAGAAGTTTTCTTCATTTAAAATGAAAACAGGTATCTTGATCAAGGTTAGTGAAATGATTATCGCTCTATTAGCTGTTCCTTTTGCGTTACCGTTTCCTGCT------GGATTACCTTTATTGTACACTGTTTACACT---------------------------------------------GCTTTATGTGTGTCAGAAATGTATTCTATCTTTGGGCATTTAAGAGTTGTGGACGATAAAAGCAAT---------TTCCTTTCCATTATTGAGGGATTCTTTAAGCAGACATATAGAAAAGATAAAGGAGAT
TRN  10010101110011000
NAM  VG14_BPPZA/7-130
ASQ  MQHFLETDETKLIY--WLTFLMVCMVVDTVLGVLFAKLNPNIKFSSFKIKTGVLIKVSEMILALLAVPFAVPFPA--GLPLLYTVYT---------------ALCVSEIYSIFGHLRLVDDKSD---FLEILENFFKRTSGKNKED
DSQ  ATGCAACACTTTTTGGAAACGGACGAGACAAAGCTAATCTAC------TGGCTAACATTCCTTATGGTTTGTATGGTTGTTGATACAGTACTGGGCGTCCTATTTGCAAAGCTTAACCCGAACATTAAATTTTCGTCATTCAAAATCAAAACAGGGGTATTAATTAAAGTTAGTGAAATGATTCTAGCGTTGTTGGCTGTTCCGTTCGCTGTTCCTTTCCCTGCG------GGTCTACCTCTATTATACACGGTTTATACG---------------------------------------------GCTTTGTGTGTATCGGAAATATATTCTATTTTCGGTCATCTGAGATTAGTTGATGATAAGAGTGAC---------TTTCTTGAAATACTTGAAAACTTCTTTAAACGTACATCCGGTAAAAATAAGGAGGAC
TRN  10010101100011000
NAM  Q9FZW1_BPGA1/5-133
ASQ  FHSLMETDDTKVYF--LLGIIGVLNIVDFFFGFINAKFNKSIAYKSSKTIDGIMRKMKFTIMAILFIPVSVLMPEPIGLGALYVFYF---------------GYIYAELNSILSHLKLSEDGKETEVFLDFINTFFNSTKGDKKDD
DSQ  TTTCATTCGTTAATGGAAACGGATGACACAAAGGTATACTTT------CTATTAGGGATAATTGGTGTTTTGAACATAGTAGACTTCTTTTTTGGGTTTATAAACGCTAAATTTAATAAATCTATAGCTTATAAATCTAGTAAAACAATAGATGGTATAATGAGAAAAATGAAATTTACTATCATGGCAATTCTGTTTATACCTGTAAGTGTTCTAATGCCTGAACCGATCGGTCTTGGAGCACTATATGTTTTCTACTTT---------------------------------------------GGTTACATTTATGCAGAGTTAAATAGTATTTTATCACACTTGAAACTAAGTGAAGACGGTAAAGAAACAGAAGTATTTTTGGATTTTATTAACACTTTCTTTAATTCTACTAAAGGAGATAAAAAAGATGAC
TRN  10010101100011000
NAM  VLYS_BPPH1/8-130
ASQ  LQIARAYLFGEVKY---LDLMLVLNIIDIITGVIKAWKFK--ELRSRSAWFGYVRKMLSFLVVIVANAIDTIMDLN-GVLTFATVL----------------FYIANEGLSITENLAQIGVKIP-AVITDRLHVIESDNDQKTEKD
DSQ  TTACAGATCGCAAGAGCATATCTTTTTGGGGAGGTGAAATAT---------CTTGATTTAATGCTGGTGCTGAACATCATTGACATCATTACCGGTGTGATAAAAGCATGGAAATTCAAG------GAGCTTCGGAGCCGCAGCGCATGGTTCGGATATGTGCGTAAGATGCTTAGTTTTCTCGTGGTTATCGTGGCGAATGCTATTGATACGATTATGGATCTGAAC---GGCGTCCTGACCTTTGCGACCGTTCTT------------------------------------------------TTTTATATTGCAAATGAGGGCCTGTCCATCACAGAAAACTTGGCGCAGATCGGCGTTAAAATTCCG---GCCGTCATCACTGACCGGCTTCATGTAATTGAAAGCGACAACGATCAGAAAACAGAAAAAGAC
TRN  10010101100011010
NAM  YQXH_BACSU/13-135
ASQ  LDLARVYLFGGVKY---LDLLLVLSIIDVLTGVIKAWKFK--KLRSRSAWFGYVRKLLNFFAVILANVIDTVLNLN-GVLTFGTVL----------------FYIANEGLSITENLAQIGVKIP-SSITDRLQTIENEKEQSKNNA
DSQ  TTAGATTTAGCAAGAGTATATTTATTTGGAGGGGTGAAGTAC---------CTTGATTTACTTCTAGTACTTAGCATAATTGACGTTTTAACAGGAGTAATCAAGGCATGGAAATTCAAA------AAACTGCGAAGTCGAAGCGCATGGTTTGGCTATGTCCGCAAGCTACTCAATTTCTTTGCGGTCATTTTAGCAAACGTGATTGATACAGTACTCAATTTGAAC---GGTGTCTTAACCTTTGGTACCGTTCTT------------------------------------------------TTTTATATCGCTAATGAAGGTTTGTCAATAACTGAAAACTTAGCACAGATTGGTGTTAAAATACCA---TCATCAATAACAGATCGATTACAAACAATTGAGAACGAAAAAGAACAGAGTAAGAATAACGCA
TRN  10010101100011000
NAM  Y965_BACHD/12-133
ASQ  LAAAVSFLYGEWTI--LLSILLTLVVIDYGTGLVAAGVTG--NINSRVGLIGITRKVFIFVMVAIAHMIDTVLLEV-GIETEALIFM-----------AAVVFYIVNELISIFENAGRMGLPVP--------KQLKQAISILKGDE
DSQ  CTTGCAGCTGCTGTCTCTTTTTTATATGGGGAGTGGACAATT------TTGCTATCAATTTTACTTACATTAGTGGTCATTGATTATGGCACGGGGCTAGTAGCAGCTGGCGTAACCGGA------AATATTAACAGTCGTGTCGGTCTTATAGGGATTACGCGCAAGGTTTTTATTTTCGTTATGGTGGCAATTGCCCACATGATCGATACTGTTCTGCTAGAGGTC---GGAATTGAAACAGAGGCTTTAATTTTTATG---------------------------------GCCGCCGTTGTTTTTTATATCGTGAACGAACTTATTAGCATCTTCGAAAATGCTGGTCGAATGGGACTACCGGTACCA------------------------AAGCAATTGAAACAGGCGATTTCCATTTTAAAAGGAGATGAA
TRN  10010101100011000
NAM  Y1842_CLOAB/9-125
ASQ  MQDMSSYMFGQWDT--PLMVLIFFMVIDYLGDIVNAAVEK--SLDFKKSYMGIAKIVSVLVVIIVSVLMDRLVNKGTWFFRTFTCY----------------FYVANEGINILENCSKLGLPMP-EKLMKTLEDLKNR--------
DSQ  ATGCAAGATATGTCCAGCTACATGTTTGGTCAGTGGGATACC------CCTTTAATGGTTCTAATATTTTTTATGGTAATAGATTATTTAGGGGATATAGTAAATGCAGCCGTAGAAAAG------AGTTTGGATTTCAAAAAAAGTTACATGGGTATTGCAAAAATAGTATCTGTATTAGTGGTTATTATAGTATCTGTTCTAATGGATAGACTTGTTAACAAAGGAACATGGTTTTTTAGAACATTTACATGTTAT------------------------------------------------TTTTACGTAGCAAATGAAGGCATAAATATTTTAGAAAACTGCAGTAAATTAGGGCTTCCTATGCCG---GAAAAACTTATGAAAACTTTAGAGGATCTAAAAAATAGA------------------------
TRN  10010101110011010
NAM  YNGD_CLOPE/15-132
ASQ  LGTLFTWIFGAWDI--PLITLLVFIFLDYLTGVIKGCKSK--ELCSNIGLRGITKKGLILVVLLVAVMLDRLLDNG-TWMFRTLIAY---------------FYIMNEGISILENCAALGVPIP--------EKLKQALKQLNNKK
DSQ  TTAGGAACTTTATTCACTTGGATATTTGGTGCATGGGATATT------CCACTAATAACTTTATTAGTATTTATTTTTTTAGATTATTTAACTGGGGTAATTAAGGGGTGTAAAAGTAAG------GAATTATGTTCGAATATAGGATTAAGGGGAATAACTAAGAAGGGTCTTATATTAGTTGTTCTTTTAGTTGCTGTTATGCTAGATAGATTACTAGATAATGGA---ACTTGGATGTTTAGAACACTTATAGCTTAT---------------------------------------------TTCTATATAATGAATGAGGGTATAAGTATATTAGAAAATTGTGCAGCCTTAGGAGTACCTATACCT------------------------GAAAAATTAAAACAAGCGTTGAAACAGTTAAATAATAAAAAA
TRN  10010101110011010
NAM  YTKC_BACSU/14-134
ASQ  SVSAAGFFFGGFQY--SFLILLSLMAIEFISTTLKETIIH--KLSFKKVFARLVKKLVTLALISVCHFFDQLLNTQ-GSIRDLAIM----------------FYILYESVQIVVTASSLGIPVP-QMLVDLLETLKNKFKRKP---
DSQ  AGCGTTTCAGCAGCGGGTTTTTTCTTTGGAGGTTTTCAGTAT------TCATTTCTGATTTTGCTCTCTCTTATGGCAATTGAATTTATCAGTACGACTTTGAAGGAAACCATTATTCAC------AAACTGTCATTTAAAAAGGTATTTGCCCGGCTTGTCAAAAAATTAGTCACGCTGGCTCTGATCTCTGTATGCCACTTTTTTGATCAGCTGCTGAATACACAG---GGATCAATTCGTGACTTGGCTATTATG------------------------------------------------TTTTATATTCTTTATGAATCTGTGCAAATTGTTGTGACAGCCAGCTCTCTTGGCATACCGGTTCCT---CAGATGCTTGTCGATCTTTTAGAAACGTTAAAAAATAAATTTAAGCGCAAACCG---------
TRN  10010101100011000
NAM  O21980_9CAUD/1-56
ASQ  ------------------------------------------------------------------------MHL--GSVIDTFIY----------------AMMAAYGSSILANLSSLGVKFPYIDRYIRLNIDKEKFILLDEEE
DSQ  ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ATGCACTTA------GGAAGCGTGATAGACACTTTCATATAT------------------------------------------------GCCATGATGGCTGCATACGGTTCAAGTATATTGGCTAACCTGTCATCTTTGGGAGTTAAATTCCCTTACATAGACAGGTATATTCGATTAAACATCGATAAAGAAAAATTCATCCTATTAGATGAAGAAGAG
TRN  10010101100011000
NAM  VLYS_BPCP1/1-123
ASQ  MLYNIMLEVAKGDY---ITILFALILFDFITGFLKAWKWK--VTDSWTGLKGVIKHTLTFIFYYFVAVFLTYIHAMAVGQILLVIIN------------------LYYALSIMENLAVMGVFIPKFMTARVQEELQKYTAQLDAGK
DSQ  ATGTTATATAATATTATGCTAGAAGTTGCTAAAGGCGACTAT---------ATCACAATTCTTTTTGCTTTGATTCTGTTTGACTTTATCACAGGCTTTTTAAAGGCTTGGAAGTGGAAA------GTGACCGATAGCTGGACAGGGTTAAAAGGAGTTATCAAACATACCCTAACATTTATTTTTTACTATTTTGTAGCGGTATTCTTAACATATATTCACGCTATGGCAGTCGGTCAGATTTTGCTTGTTATCATTAAC------------------------------------------------------TTGTACTATGCACTTTCAATTATGGAAAATCTTGCTGTTATGGGTGTCTTTATCCCTAAATTTATGACGGCTAGAGTACAGGAAGAATTGCAGAAATACACCGCACAACTAGACGCAGGAAAA
TRN  10010101100011000
NAM  Q9ZIB0_CLODI/20-163
ASQ  LGGVMNMTISFLSEHIFIKLVILTISFDTLLGCLNAIKSR--KFNSSFGIDGGIRKVAMIACIFFLSVVDILTKFNFLFMLPQDCINFLRLQHLGISEFFSILFILYESVSILKNMCLCGLPVPKRLKEKIVVLLDAMTDEMNAKG
DSQ  CTAGGGGGCGTTATGAATATGACAATATCTTTTTTATCAGAGCATATATTTATAAAGTTAGTAATTTTAACTATATCATTTGATACATTATTAGGATGTTTAAATGCAATAAAAAGTCGT------AAATTCAATTCTAGTTTTGGAATAGATGGAGGAATCAGAAAAGTAGCAATGATAGCATGTATATTTTTTTTATCAGTAGTTGATATTCTTACAAAGTTTAACTTTTTATTTATGTTACCACAAGATTGTATCAATTTTTTAAGACTACAACATCTTGGAATATCTGAATTTTTCTCTATTTTATTTATTTTATATGAAAGTGTAAGCATATTAAAAAATATGTGCTTATGTGGATTACCAGTACCTAAGAGATTAAAGGAAAAAATAGTAGTTTTACTAGATGCAATGACAGATGAAATGAATGCTAAGGGT
TRN  10010101110011000
NAM  Q46343_CLOSO/1-140
ASQ  ----MNITISFLSKNIFIKLVMLAITFDTLLGCLRAIKTH--KFNSSFGINGGIRKIAMIACIFFLSIVDMLTQFNFLFILPQEYINFFRFQHLGISEFFSMLFIFYESISILKNMYLCGLPVPKNIQNKMYNLLYTITDEVKIED
DSQ  ------------ATGAATATAACAATATCTTTTTTATCAAAAAATATATTTATAAAACTAGTGATGCTAGCTATAACATTTGATACATTATTGGGATGTTTGAGGGCAATAAAAACCCAT------AAATTTAATTCTAGTTTTGGAATCAATGGAGGAATTAGAAAAATAGCAATGATAGCTTGTATATTTTTTCTATCAATAGTTGATATGCTAACACAATTCAATTTTTTATTTATATTGCCACAAGAATATATTAATTTTTTTAGATTTCAACATCTAGGAATATCAGAATTTTTTTCTATGCTATTTATTTTTTATGAAAGTATAAGTATATTAAAAAATATGTATCTATGTGGTTTACCAGTACCTAAAAATATACAAAACAAAATGTATAATTTGTTATATACAATAACAGACGAAGTAAAAATTGAGGAT
TRN  10010101110011000
//