EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05082 - DUF683)
FAM  PF05082
PID  DUF683
DES  Protein of unknown function (DUF683)
IPR  IPR007774
ANO  11
ALN  67
AID  0.408428
APH  ((((YNI1_ANAVA/16-81:0.32409,Y1434_ANASP/5-70:0.16073):0.09808,O07359_SYNP8/11-76:0.28561):0.29938,(((Q44536_AZOVI/3-69:1.33383,Q9FA18_ACEDI/1-66:0.08644):0.27424,YFXX_AZOCA/1-66:0.34428):0.19132,((Q98AM9_RHILO/1-66:0.43664,Y4XE_RHISN/1-66:0.19800):0.06631,Q98AS9_RHILO/25-90:0.17467):0.29348):0.12625):0.50110,Q9Z5Y1_FRASE/12-77:0.20716,YNI1_FRAAL/17-81:0.29573);
ATP  ((((YNI1_ANAVA/16-81,Y1434_ANASP/5-70),O07359_SYNP8/11-76),(((Q44536_AZOVI/3-69,Q9FA18_ACEDI/1-66),YFXX_AZOCA/1-66),((Q98AM9_RHILO/1-66,Y4XE_RHISN/1-66),Q98AS9_RHILO/25-90))),Q9Z5Y1_FRASE/12-77,YNI1_FRAAL/17-81);
ATL  5.69731
DNO  11
DLN  201
DID  0.491744
DPH  (Y1434_ANASP/5-70:0.14511,(O07359_SYNP8/11-76:0.21060,((((Q9FA18_ACEDI/1-66:0.18987,Q44536_AZOVI/3-69:0.56848):0.07603,(YNI1_FRAAL/17-81:0.16282,Q9Z5Y1_FRASE/12-77:0.17762):0.28519):0.08118,YFXX_AZOCA/1-66:0.28293):0.19709,(Y4XE_RHISN/1-66:0.14588,(Q98AS9_RHILO/25-90:0.14120,Q98AM9_RHILO/1-66:0.26460):0.04293):0.17069):0.41086):0.17153,YNI1_ANAVA/16-81:0.29600);
DTP  (Y1434_ANASP/5-70,(O07359_SYNP8/11-76,((((Q9FA18_ACEDI/1-66,Q44536_AZOVI/3-69),(YNI1_FRAAL/17-81,Q9Z5Y1_FRASE/12-77)),YFXX_AZOCA/1-66),(Y4XE_RHISN/1-66,(Q98AS9_RHILO/25-90,Q98AM9_RHILO/1-66)))),YNI1_ANAVA/16-81);
DTL  4.02061
RID  0.408428
RPH  ((((YNI1_ANAVA/16-81:0.32409,Y1434_ANASP/5-70:0.16073):0.09808,O07359_SYNP8/11-76:0.28561):0.29938,(((Q44536_AZOVI/3-69:1.33383,Q9FA18_ACEDI/1-66:0.08644):0.27424,YFXX_AZOCA/1-66:0.34428):0.19132,((Q98AM9_RHILO/1-66:0.43664,Y4XE_RHISN/1-66:0.19800):0.06631,Q98AS9_RHILO/25-90:0.17467):0.29348):0.12625):0.50110,Q9Z5Y1_FRASE/12-77:0.20716,YNI1_FRAAL/17-81:0.29573);
RTP  ((((YNI1_ANAVA/16-81,Y1434_ANASP/5-70),O07359_SYNP8/11-76),(((Q44536_AZOVI/3-69,Q9FA18_ACEDI/1-66),YFXX_AZOCA/1-66),((Q98AM9_RHILO/1-66,Y4XE_RHISN/1-66),Q98AS9_RHILO/25-90))),Q9Z5Y1_FRASE/12-77,YNI1_FRAAL/17-81);
RTL  5.69731
LNK  O07359_SYNP8/11-76:O07359:AF003700
LNK  Q44536_AZOVI/3-69:Q44536:M20568
LNK  Q98AM9_RHILO/1-66:Q98AM9:BA000012
LNK  Q98AS9_RHILO/25-90:Q98AS9:BA000012
LNK  Q9FA18_ACEDI/1-66:Q9FA18:AF030414
LNK  Q9Z5Y1_FRASE/12-77:Q9Z5Y1:AF119361
LNK  Y1434_ANASP/5-70:Q44148:U47055
LNK  Y4XE_RHISN/1-66:P55696:AE000105
LNK  YFXX_AZOCA/1-66:P26486:X55450
LNK  YNI1_ANAVA/16-81:Q44491:U49859
LNK  YNI1_FRAAL/17-81:P46041:L29299
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  YNI1_ANAVA/16-81
ASQ  QQTIEGLKLQIKKLNSKAGQLKMDLHDLAEG-LPIDYQNLTALAAETYEIYRHLDELKSQLKSLEKN
DSQ  CAACAGACGATTGAAGGGTTAAAACTACAAATTAAGAAACTGAACAGTAAGGCTGGTCAATTGAAGATGGATCTGCATGATTTGGCTGAAGGT---TTGCCAATTGATTACCAAAATTTGACTGCACTAGCAGCCGAAACTTATGAAATCTATCGTCATTTAGATGAATTAAAGTCTCAGCTAAAAAGTTTGGAGAAAAAT
TRN  11011101101011010
NAM  Y1434_ANASP/5-70
ASQ  ETSIEEIQTKIKRLNSKAGQMKMDLHDLAEG-LPTDYTQLMDVAAATYEIYRQLDELKQELKKLENA
DSQ  GAAACAAGTATTGAGGAAATACAAACTAAAATCAAACGCCTCAATAGTAAAGCCGGGCAAATGAAAATGGATCTGCACGATTTAGCAGAAGGT---TTGCCAACGGATTACACCCAACTAATGGACGTTGCGGCTGCAACTTATGAAATTTATCGTCAGCTAGATGAACTCAAGCAAGAGTTGAAGAAATTGGAGAATGCG
TRN  10010101100011010
NAM  O07359_SYNP8/11-76
ASQ  AEEIDDLRKSIKRLNSVAGQMKMDLHDLAEG-LPTDYENLLDTAQKTYDIFRQLDTLKKQLKTWEEL
DSQ  GCAGAAGAGATAGACGATCTCAGAAAATCCATCAAACGACTCAATTCAGTAGCGGGTCAAATGAAAATGGATTTACACGATCTAGCAGAAGGA---TTACCAACGGATTATGAAAACTTGCTAGACACTGCTCAGAAAACCTACGACATTTTTCGTCAATTAGACACCCTAAAAAAACAACTCAAAACTTGGGAGGAACTG
TRN  10010101100011000
NAM  YFXX_AZOCA/1-66
ASQ  MSDIETLKAEIKKLSAKSVNAKMNLHDLSED-LPTNWQSILEVAQETYNTFKTLEDARKKLKELEAG
DSQ  ATGTCCGACATCGAGACCCTCAAGGCCGAGATCAAGAAGCTCTCTGCCAAGTCGGTGAATGCCAAGATGAACCTGCACGACCTCTCCGAGGAC---CTGCCCACCAATTGGCAGAGCATCCTCGAGGTGGCGCAGGAGACCTACAACACCTTCAAGACGCTGGAAGACGCCCGCAAGAAGCTCAAGGAACTGGAAGCCGGT
TRN  11011111101111111
NAM  Q9FA18_ACEDI/1-66
ASQ  MTDIAELKAELKKLSARATKAKMDLHDLSED-LPVNWQAIPDIAAQAHRAFAELTEKRAALAAIEDA
DSQ  ATGACGGATATCGCGGAACTGAAGGCGGAACTGAAGAAGCTGTCCGCCCGGGCCACCAAGGCGAAGATGGATCTGCACGATCTGTCCGAGGAC---CTGCCCGTCAACTGGCAGGCGATTCCCGACATCGCCGCGCAGGCGCATCGGGCCTTTGCCGAACTGACCGAAAAACGCGCGGCGCTGGCCGCGATCGAAGACGCG
TRN  11011101101011011
NAM  Y4XE_RHISN/1-66
ASQ  MTDLEELKQRVQKLQSRAATAKTQLHDLAEC-LPNYWTEIVAVAEKTFDAFAQLDAAKRELAASENS
DSQ  ATGACAGATCTTGAAGAACTCAAGCAGAGGGTTCAAAAACTGCAGTCACGCGCTGCGACTGCGAAGACGCAATTGCATGACCTTGCCGAGTGC---CTTCCGAACTATTGGACCGAAATAGTGGCCGTCGCCGAAAAAACATTCGACGCTTTTGCTCAGTTGGACGCTGCCAAAAGAGAACTCGCCGCGTCGGAGAATTCA
TRN  10010101100011001
NAM  Q98AS9_RHILO/25-90
ASQ  MSDLALLQKKVRKLQSRAGAAKMELHDLAED-LPVNWTEIEAVAWKAFEVFAELDAAKEELAALENS
DSQ  ATGTCAGACCTTGCGCTGTTACAGAAGAAGGTCCGCAAGCTGCAGTCGCGCGCGGGAGCCGCCAAGATGGAATTGCACGACCTTGCCGAGGAC---CTTCCGGTCAACTGGACCGAGATCGAGGCGGTCGCCTGGAAAGCCTTCGAGGTTTTTGCCGAGTTGGATGCGGCAAAGGAAGAACTCGCAGCGTTGGAGAATTCA
TRN  11011101101011000
NAM  Q98AM9_RHILO/1-66
ASQ  MSNLDEMAKKVRKLQLRAAIAKTNLRDLAEG-LPVKWIEIEEVAEKTHAAYAELDGARRELAKMKTL
DSQ  ATGTCAAACCTGGATGAGATGGCGAAGAAAGTCCGAAAGCTTCAACTGCGCGCGGCAATTGCCAAGACGAACTTGCGCGATCTTGCCGAGGGT---CTCCCGGTCAAATGGATTGAGATAGAGGAAGTCGCCGAGAAAACGCATGCCGCTTATGCCGAGTTGGATGGTGCCAGGAGAGAGCTTGCCAAAATGAAGACTTTG
TRN  10010101100011001
NAM  YNI1_FRAAL/17-81
ASQ  NLDAAAAQQRLRKLHSKATRLKLDLHDLAED-LPIGWEGLLDVARRTYDAYAEIALLEG-LAEKETS
DSQ  AACCTCGACGCCGCCGCCGCCCAGCAGCGGCTGCGCAAGCTCCACAGCAAGGCCACCCGACTCAAGCTTGATCTTCACGACCTCGCCGAGGAC---CTCCCGATCGGCTGGGAGGGCCTGCTCGACGTCGCCCGCCGGACCTATGACGCCTATGCCGAGATCGCCCTGTTGGAGGGC---CTGGCCGAGAAGGAGACGTCG
TRN  11011111101111111
NAM  Q9Z5Y1_FRASE/12-77
ASQ  GTDEAALKARLRKMNSKASQLKLDLHDLSEE-LPLGWENILDLARRTYDAYAEIALLENELRAGAAG
DSQ  GGTACCGACGAGGCCGCCCTCAAGGCCCGGCTGCGCAAGATGAACAGCAAGGCCTCGCAGCTCAAGCTCGATCTGCACGATCTCTCCGAGGAA---CTGCCGCTCGGCTGGGAGAACATCCTCGACCTCGCCCGCCGCACCTACGACGCCTACGCCGAGATCGCGCTGCTGGAGAACGAGCTGCGTGCCGGCGCGGCCGGC
TRN  11011111101111111
NAM  Q44536_AZOVI/3-69
ASQ  EDEIKALKKEVSQKKRIATEWASQIHDLVEDRLFNDYESLPELARQARQACVEWAEAKARLDATGAA
DSQ  GAAGACGAAATCAAGGCCCTGAAGAAAGAGGTAAGCCAGAAGAAGCGCATCGCGACCGAATGGGCTTCGCAGATCCACGATCTGGTCGAGGATCGCCTGTTCAACGATTACGAATCGCTGCCGGAGCTGGCCCGCCAGGCCCGTCAAGCCTGTGTCGAGTGGGCCGAAGCCAAGGCGCGTCTCGACGCGACCGGCGCCGCC
TRN  11011101101011011
//