EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05045 - RgpF)
FAM  PF05045
PID  RgpF
DES  Rhamnan synthesis protein F
IPR  IPR007739
ANO  7
ALN  514
AID  0.397832
APH  (Q985R7_RHILO/34-532:0.13656,Q985R6_RHILO/34-532:0.19615,(O66255_ACTAC/34-530:0.56958,(((Q9A0G0_STRPY/34-514:0.25719,O82878_STRMU/34-515:0.21421):0.04248,Q9CIZ9_LACLA/34-519:0.43551):1.07840,Q985R5_RHILO/34-529:0.37867):0.12656):0.16691);
ATP  (Q985R7_RHILO/34-532,Q985R6_RHILO/34-532,(O66255_ACTAC/34-530,(((Q9A0G0_STRPY/34-514,O82878_STRMU/34-515),Q9CIZ9_LACLA/34-519),Q985R5_RHILO/34-529)));
ATL  3.60222
DNO  7
DLN  1542
DID  0.496425
DPH  ((Q9CIZ9_LACLA/34-519:0.29513,(O66255_ACTAC/34-530:0.35163,(Q985R5_RHILO/34-529:0.37013,(Q985R6_RHILO/34-532:0.15082,Q985R7_RHILO/34-532:0.12613):0.17668):0.18621):0.52872):0.06808,Q9A0G0_STRPY/34-514:0.25374,O82878_STRMU/34-515:0.20391);
DTP  ((Q9CIZ9_LACLA/34-519,(O66255_ACTAC/34-530,(Q985R5_RHILO/34-529,(Q985R6_RHILO/34-532,Q985R7_RHILO/34-532)))),Q9A0G0_STRPY/34-514,O82878_STRMU/34-515);
DTL  2.71118
RID  0.397832
RPH  (Q985R7_RHILO/34-532:0.13656,Q985R6_RHILO/34-532:0.19615,(O66255_ACTAC/34-530:0.56958,(((Q9A0G0_STRPY/34-514:0.25719,O82878_STRMU/34-515:0.21421):0.04248,Q9CIZ9_LACLA/34-519:0.43551):1.07840,Q985R5_RHILO/34-529:0.37867):0.12656):0.16691);
RTP  (Q985R7_RHILO/34-532,Q985R6_RHILO/34-532,(O66255_ACTAC/34-530,(((Q9A0G0_STRPY/34-514,O82878_STRMU/34-515),Q9CIZ9_LACLA/34-519),Q985R5_RHILO/34-529)));
RTL  3.60222
LNK  O66255_ACTAC/34-530:O66255:AB010415
LNK  O82878_STRMU/34-515:O82878:AB010970
LNK  Q985R5_RHILO/34-529:Q985R5:BA000012
LNK  Q985R6_RHILO/34-532:Q985R6:BA000012
LNK  Q985R7_RHILO/34-532:Q985R7:BA000012
LNK  Q9A0G0_STRPY/34-514:Q9A0G0:AE006530
LNK  Q9CIZ9_LACLA/34-519:Q9CIZ9:AE006258
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q985R7_RHILO/34-532
ASQ  IIFVSNGEISQSSEASLRS--TVDETIIRENTGFDVGAYRDGLEFIGYDKLGDYDEILLLNHTFYGPVFPFSEMFSEMERR-ACDFWGISDHKEVSPNPF.TGAGVLPRHLNSHFIAVRKAMLESIAFRNYWERMPKITDYAESVLLHESRFTGFFENLGYKSETYLDSDKYNSAYPVMIDVDQIYNDRSPILKRRLFFNDPTFLDKNAV--DLPRALRVLKETSDYDLNLIWRNVLRSSDLRTLNTNAALMSVLPDKRIKGDGAAA-DYGKIAVCAHIYYTDMLDEILGLTGNIPVPYDFIATTNTPEKKAEIETA-LANRPGVKNVIVRVVEQNRGRDMSSLFISLRDLLVDDRYDLVCRLHTKKSPQVQSSMGNLFKRHMVDNLLNSRGYVHNVLDMFHDNPSVGLAIPPI-FHISYPTMGFSWFAN-.-KPKVEETARLLNINVKFD---ENTPVAAYGTMFWFRPRALRKMFEHKWKWEEFNAEPDHVDGGFAHALERLIAYAVQNAGY
DSQ  ATTATTTTTGTCTCAAACGGAGAAATTTCACAATCATCGGAGGCTTCACTGCGATCC------ACCGTTGACGAGACTATTATCCGTGAGAATACAGGATTTGACGTTGGGGCGTATCGCGACGGGCTCGAGTTCATCGGTTACGACAAGCTCGGCGATTATGATGAAATCCTTTTGCTTAACCACACATTCTACGGACCTGTTTTCCCGTTCTCGGAAATGTTTTCGGAAATGGAACGCCGG---GCCTGCGATTTTTGGGGCATATCCGATCACAAGGAGGTAAGCCCCAATCCTTTC...ACTGGAGCAGGGGTTTTGCCCCGCCATCTGAACTCTCATTTTATCGCCGTGAGAAAGGCGATGCTTGAGTCGATCGCTTTTCGAAACTATTGGGAGAGAATGCCGAAAATCACAGACTATGCGGAGTCTGTTCTCTTGCATGAGTCGCGTTTTACAGGTTTTTTCGAGAACCTGGGATACAAATCTGAAACGTATCTTGACTCGGATAAATACAATTCCGCGTATCCTGTGATGATCGATGTCGATCAGATTTACAATGATAGAAGCCCAATTTTAAAGCGTCGTCTTTTTTTCAATGATCCAACATTTTTGGATAAGAACGCCGTC------GATTTGCCGCGTGCTTTGCGGGTGCTGAAAGAGACATCCGACTACGACCTCAATCTGATTTGGCGCAATGTCCTGCGCTCTTCGGATTTGAGAACCCTCAACACCAATGCGGCGCTGATGAGTGTCTTGCCGGACAAGCGGATTAAAGGCGACGGTGCTGCTGCC---GACTATGGCAAGATCGCTGTCTGCGCGCATATCTACTACACCGATATGCTCGACGAGATACTGGGCCTGACTGGCAATATCCCGGTACCCTATGATTTCATTGCCACCACGAATACGCCGGAGAAAAAGGCCGAAATCGAAACCGCC---CTGGCGAACCGCCCTGGTGTGAAGAACGTCATCGTCCGGGTTGTCGAGCAGAACCGCGGCCGTGACATGTCCTCACTTTTCATCTCCTTGCGCGATCTGCTGGTCGACGATCGCTATGACCTTGTCTGTCGCCTGCATACAAAAAAATCGCCTCAAGTGCAGTCGTCGATGGGCAACCTGTTCAAGCGGCATATGGTTGACAATCTGCTGAATAGCCGTGGCTACGTGCACAATGTGTTGGATATGTTTCACGACAACCCGTCAGTCGGACTGGCCATTCCGCCTATC---TTTCATATCTCATATCCGACCATGGGGTTCTCGTGGTTTGCCAAC---...---AAGCCAAAGGTTGAGGAAACCGCGCGGCTTTTGAACATCAACGTCAAGTTCGAC---------GAGAACACTCCGGTGGCTGCGTATGGTACCATGTTCTGGTTCCGGCCACGCGCCCTGCGCAAAATGTTCGAACACAAGTGGAAATGGGAGGAGTTCAATGCCGAGCCGGATCATGTCGACGGCGGCTTCGCTCATGCGCTGGAGCGGCTGATCGCCTACGCGGTTCAGAATGCTGGATAT
TRN  10010101100011000
NAM  Q985R6_RHILO/34-532
ASQ  IVVVSNGNLSKLSEIAIKA--SCDQLLVRENVGFDVWGYKTGIDAVGFDALSEYDELILLNDTCYGPLFPFSEMFSEMERR-DCDFWGSAAHSKMTPNPF.TGTGHLPRHLTANFIAVREKMLKSRAFKTYWENLPAIKTYIDAIMLHESQFTKHFTDLGYSAEAYVDPDKYGSHYPAFINVDETIINRFPLLKRRPFFHDPTFLNAQGI--DLPRALRVLEETSDYDLNLIWRNVLRTSELRNLNTNAALMSVLPDERAKDDDAPS-DYGKIAVCAHIYYTDMLEEILALTGNIPVPYDFIATTDTPDKKAEIEAT-LAKRPGVKNVIVRVVEKNRGRDMSSLFISLRDLLVDDRYDLVCRLHTKKSPQVQASRSNLFKRHMLENLLNTRGYVHNVLDMFHDNPSVGLAVPPV-VHISYPTMGHAWFFN-.-RPKVEETARLLNIKVKFD---HDTPVAAYGTMFWFRPRALRKMFEHKWKWEDFNAEPNHVDGGLAHVLERLIAYAAQDAGY
DSQ  ATTGTTGTCGTATCCAACGGAAATCTTTCCAAGCTTTCGGAAATAGCAATCAAAGCC------AGTTGTGATCAGCTTCTGGTCCGGGAGAACGTGGGATTTGACGTATGGGGATACAAGACCGGTATCGACGCTGTCGGCTTTGACGCTCTTTCCGAGTATGATGAACTTATCCTGCTGAATGACACTTGCTACGGGCCTCTTTTCCCGTTTTCGGAAATGTTTTCTGAAATGGAGCGCCGG---GATTGTGATTTCTGGGGCAGCGCTGCCCATTCGAAAATGACGCCAAATCCGTTT...ACCGGAACGGGCCATCTGCCTCGCCACCTCACAGCAAACTTCATTGCTGTCCGCGAGAAGATGTTGAAATCACGCGCCTTCAAAACATACTGGGAAAATCTGCCGGCGATCAAAACTTACATCGACGCTATCATGCTTCACGAGTCGCAGTTTACCAAGCATTTTACAGATCTTGGCTACTCGGCGGAAGCGTATGTTGATCCGGATAAGTATGGCTCGCACTATCCGGCGTTTATTAACGTGGATGAGACAATCATCAACCGCTTCCCCTTGCTAAAGCGACGTCCGTTTTTTCATGATCCGACGTTTTTGAATGCTCAAGGCATT------GATTTGCCGCGCGCTTTGCGAGTTCTTGAGGAGACATCCGACTACGACCTCAATCTGATTTGGCGCAATGTCCTGCGCACTTCGGAATTGAGGAATCTAAACACGAATGCCGCGCTGATGAGCGTCTTGCCCGATGAGCGAGCCAAAGACGATGACGCTCCTTCC---GACTACGGCAAGATCGCTGTCTGCGCGCATATCTACTACACCGATATGCTGGAAGAGATACTGGCGCTGACCGGCAACATCCCGGTTCCCTATGATTTCATTGCCACGACGGATACGCCGGATAAAAAGGCCGAGATTGAAGCCACA---CTGGCAAAACGCCCTGGCGTGAAGAACGTCATCGTCCGCGTGGTCGAGAAAAATCGCGGTCGTGACATGTCCTCGCTTTTCATTTCCTTGCGCGATCTGCTCGTCGACGACCGTTATGACCTTGTGTGTCGCCTGCATACAAAAAAGTCGCCTCAAGTGCAGGCGTCGAGAAGCAACCTGTTCAAGCGGCATATGCTTGAGAACTTGCTGAATACGCGTGGCTATGTCCACAATGTTTTGGATATGTTTCACGACAATCCGTCAGTCGGACTAGCCGTTCCGCCTGTC---GTTCATATTTCCTATCCGACGATGGGGCACGCATGGTTCTTCAAC---...---AGACCAAAGGTTGAGGAAACCGCGCGGCTTTTGAACATCAAGGTCAAGTTCGAT---------CATGACACCCCGGTGGCTGCCTATGGCACCATGTTCTGGTTTCGGCCACGCGCCCTGCGCAAGATGTTCGAACACAAGTGGAAATGGGAAGACTTCAATGCCGAGCCAAATCATGTTGACGGCGGCTTGGCTCATGTGCTGGAGCGGCTGATCGCCTATGCGGCTCAGGACGCTGGATAT
TRN  10010101100011001
NAM  Q985R5_RHILO/34-529
ASQ  LLVVCNGPIDDEARSRLPD--ATDSFLIRENKGFDVWAYRTALEHIGWDELSQFDEILFFNHTFYGPIFPFSEMFSEMDQR-HCDFWGISAHKAIRPNPIdVRKSELPFHLNSHFIAVRRSLHQSKAFRDYWTRMVSINSYIESVAKHETVFTAHFQALGYTCSVLLDPERYRTPYPVFMEPDKTLEDRSPILKRRLFFHDTLSLERAAI--NLPRALEIIENQSDYDLSLIWKSVGRLGSPRTLNGNAALLSVLPDVQVGP--QRNWDDCRIAVLAHVYHLDMIDEILGYAENVPKGYDLIVTTDNADKQALIQQA-IAKATNASNAVVLVV-RNDGRDTSALLVGCRDYVLEDRYDLICRVHSKRSPQ-DGPRGELFKLHTFENLLHTPGYVSNLLELFANNPALGLVMPPL-VHIGYPTIGNSWAGN-.-KANVAKLARQLGLIVHLD---DSTPVAPYGGMYWFRPAALRKLFEERWNWNDFANMD-YRDGSLVHAIERIIAYVAIDAGY
DSQ  CTGCTGGTCGTTTGCAACGGTCCGATAGACGACGAGGCTCGATCTCGCCTTCCTGAC------GCTACCGACAGCTTTCTGATCAGGGAAAACAAGGGGTTCGATGTTTGGGCCTATCGGACTGCCCTCGAACATATCGGGTGGGATGAGCTTTCACAGTTCGACGAGATATTGTTTTTCAACCACACTTTCTACGGGCCGATTTTTCCCTTCTCCGAAATGTTCTCGGAGATGGACCAACGT---CACTGTGACTTTTGGGGAATCTCCGCCCACAAGGCGATAAGGCCCAATCCGATCgacGTCAGAAAATCGGAACTGCCCTTCCATCTCAATTCCCATTTCATAGCAGTGCGGCGGTCCTTGCATCAGTCGAAGGCGTTTCGTGACTATTGGACCCGGATGGTGTCCATCAACTCCTATATAGAGTCAGTTGCGAAGCACGAGACGGTGTTCACAGCGCATTTTCAGGCTTTGGGTTACACCTGTTCGGTATTGCTCGATCCCGAACGATACAGGACGCCATACCCGGTTTTCATGGAGCCGGACAAAACGCTGGAGGACCGGAGCCCGATCCTGAAGCGGCGCCTCTTCTTTCATGACACGCTGTCCCTTGAGCGCGCGGCCATC------AACCTGCCGCGTGCTTTGGAGATCATAGAGAACCAATCTGACTATGATTTGTCGCTGATATGGAAAAGCGTTGGCCGCTTGGGCTCGCCTCGTACGCTAAACGGTAACGCCGCATTGCTCTCCGTCCTGCCGGATGTCCAGGTCGGTCCG------CAAAGGAATTGGGACGATTGTCGGATAGCTGTTCTCGCGCATGTCTATCACCTCGACATGATCGACGAGATTCTCGGCTATGCCGAAAACGTGCCGAAGGGCTATGACCTGATCGTCACGACCGACAATGCCGATAAGCAGGCCTTGATTCAGCAAGCG---ATCGCGAAGGCGACGAACGCCAGCAATGCGGTCGTCCTGGTCGTC---CGCAACGACGGCAGGGATACGTCCGCCCTTCTTGTCGGTTGCCGGGACTATGTACTTGAAGACCGGTACGACTTGATCTGCCGGGTCCATTCCAAGCGATCTCCCCAA---GACGGCCCGAGGGGAGAGTTGTTTAAACTCCACACTTTTGAAAACCTTCTTCACACGCCTGGCTATGTCTCGAATTTGCTTGAACTCTTTGCCAACAATCCAGCGCTTGGTCTCGTCATGCCACCGTTG---GTTCATATTGGCTATCCGACCATTGGAAATTCATGGGCTGGCAAC---...---AAAGCCAACGTGGCAAAGCTTGCCCGACAGTTGGGCCTGATCGTGCATTTGGAT---------GATAGTACACCTGTCGCGCCTTACGGCGGGATGTATTGGTTTCGTCCTGCAGCTCTAAGGAAGCTTTTCGAAGAAAGGTGGAACTGGAACGATTTTGCCAATATGGAT---TATCGGGATGGGAGTTTGGTCCATGCCATAGAGCGGATCATAGCCTATGTTGCAATCGACGCCGGCTAT
TRN  10010101100011001
NAM  O66255_ACTAC/34-530
ASQ  IWFVSNSGLTVESRKKIQG--CTDHIMCRENIGFDVWGYKEAIEKIGFEKLAEYDEVILLNYTFFAPIFPFCELFEWSENQ-DIDFWGISDHAEIKPNPY.TGTGVLPKHIQSHFIAIRKGLLGSYEFQDYWKNMPMINSYTDSVLMHESKFTDYFLSKGYSYSVYISSDNFPVNYPTFLSIEETLKHRCPILKRRPFFHDPIYHDVECL--FLRRSIEYVENNTTYDTSLIFKNILRTTKPKDLATNLTLLKVFDSSKVE----KVRSDIKILVVAHIYYSDMLDEIISYTQNIPCSYDLLITTANEKSKLEIESNPILKMSGAKGINVKVVEQNRGRDMSSLFITCKQEIISERYDWVCRLHSKKSPQNSHNMSIHFKEMMYLNILKDKAYISKVINYLDKNKSIGFAMPSM-VHIGHPTLGHAWFTN-.-RDLAIKIAERVGIKLPFD---DISPFAAYGTMFWFRPEALKKLFEYNWKFEDFNKEPMHQDSSLAHILERLLVYAAHDAGY
DSQ  ATTTGGTTTGTCTCAAACTCTGGGTTAACAGTAGAATCTCGTAAGAAGATCCAAGGC------TGCACAGATCATATTATGTGTAGAGAAAATATCGGTTTTGATGTTTGGGGTTATAAAGAAGCAATTGAAAAAATTGGTTTTGAAAAACTAGCTGAATATGATGAAGTTATTTTATTAAATTATACTTTCTTTGCCCCTATTTTCCCATTTTGTGAATTATTCGAATGGTCTGAAAATCAA---GATATAGATTTTTGGGGGATCTCTGATCATGCTGAAATAAAACCTAATCCTTAT...ACTGGAACAGGTGTTTTGCCTAAACATATACAATCACATTTCATTGCAATTAGGAAAGGATTATTAGGTTCTTATGAATTCCAAGATTATTGGAAAAATATGCCAATGATAAATTCGTATACTGACTCAGTATTAATGCATGAATCTAAATTTACAGATTATTTTTTATCTAAAGGATATAGTTACTCTGTTTATATTAGCTCTGATAATTTTCCAGTAAATTATCCAACATTCTTATCTATAGAAGAAACTTTAAAACATCGTTGTCCAATTTTAAAAAGAAGACCATTCTTTCATGATCCAATCTATCATGATGTAGAATGTTTA------TTTTTGCGTAGAAGTATAGAGTATGTTGAAAATAATACAACTTATGATACAAGTCTTATCTTTAAAAATATCCTAAGGACTACTAAGCCTAAAGATCTTGCAACTAATTTGACATTATTAAAAGTGTTTGATTCATCTAAAGTTGAA------------AAAGTAAGAAGTGATATTAAGATTTTAGTCGTGGCTCATATTTACTACTCAGATATGCTTGATGAAATTATTAGTTATACACAAAATATTCCTTGTTCTTATGATTTACTTATTACAACTGCTAATGAGAAAAGTAAGTTAGAGATTGAATCGAATCCAATACTTAAAATGAGTGGAGCTAAAGGTATTAATGTAAAAGTTGTTGAACAAAACCGTGGTAGAGATATGTCATCTTTATTCATTACCTGTAAGCAGGAAATAATATCGGAAAGATATGATTGGGTATGCCGACTTCATTCGAAGAAGTCTCCTCAAAATTCTCATAATATGTCTATACATTTTAAAGAAATGATGTATTTAAATATTTTGAAAGATAAAGCTTATATTTCAAAAGTTATTAATTACTTAGACAAAAATAAATCAATAGGGTTTGCAATGCCATCAATG---GTTCATATTGGACACCCTACTTTAGGCCACGCTTGGTTCACTAAT---...---AGAGACTTAGCAATAAAAATAGCAGAGAGAGTTGGTATTAAATTACCCTTTGAT---------GATATATCTCCGTTTGCGGCATATGGAACAATGTTTTGGTTTAGACCTGAAGCATTGAAAAAGCTTTTTGAATATAACTGGAAATTTGAAGATTTTAATAAAGAGCCGATGCATCAGGATAGTTCATTAGCACATATTCTAGAACGTTTATTAGTTTATGCAGCTCATGATGCAGGCTAT
TRN  10010101110011000
NAM  Q9CIZ9_LACLA/34-519
ASQ  VIFISNSELSEQYQQQLVD--FVDEFIQRENKGFDFAAWRDGMEQVGFDQLKMYDSVTLMNDTCFGPLYEMAPIYEKYEIQ-NIDFWGITNHRAYHES--.-KNHYFDEHIQSYYKVFNNNVINSQIFEDFWKNIVDYTNVQDVIDHYEIQSTKIFMDAGFKYESVLDTRALDAKN--LLHPDFSYYAPDVILKEKVPFIKVKAFQSIQSNGIAYYMLDYIDRNTDYPKSLVVDHLSTVGYP-DLN------FLLPSKMITPLSKTVL-HQTVAVHLHVYYPELLEEFLDAFKNFSFDYDLYLTTNTDEKEEIIKEM-L-KCKD-AKAKLVRT-PNHGRDIVPFL-ALKEEL--KKYDIVGHFHTKRSLEAAFFAGESWRTELISMLIEP---ADNIMAHFEQKQKLGIVIADIPSFFRFNKIVNADNENKqIAPIMNDIWKRMKMNKKVNFHDFNTFTMSYGTFFWAKIEVLEPLFNLEIMDREIPNEP-LPQNTILHAIERVLIYLAWDKEM
DSQ  GTAATTTTTATCTCAAACAGTGAGTTATCAGAACAATATCAACAACAACTTGTTGAC------TTTGTTGATGAGTTCATTCAACGTGAAAATAAAGGTTTTGACTTCGCTGCTTGGCGTGATGGGATGGAGCAAGTAGGGTTTGACCAATTAAAGATGTATGATTCGGTTACACTGATGAATGACACTTGTTTTGGTCCTCTTTATGAAATGGCCCCTATTTATGAAAAGTATGAAATACAA---AATATTGATTTTTGGGGGATAACAAATCATCGTGCCTATCATGAATCA------...---AAAAATCACTATTTCGATGAGCATATTCAGTCTTATTACAAAGTATTCAACAATAATGTTATTAATTCACAGATCTTTGAAGATTTTTGGAAAAATATTGTTGATTATACGAATGTTCAAGATGTTATTGACCATTACGAAATTCAATCTACAAAAATTTTTATGGATGCTGGGTTTAAATATGAATCTGTTCTTGATACAAGGGCTCTAGATGCAAAAAAT------CTTTTGCATCCAGATTTTTCTTATTATGCACCAGATGTAATCCTTAAAGAAAAAGTACCCTTTATTAAAGTTAAAGCGTTCCAAAGCATTCAAAGCAATGGTATTGCTTATTATATGCTGGACTATATTGATAGAAACACCGACTATCCAAAATCACTTGTTGTTGATCATCTCAGTACAGTTGGTTATCCA---GATTTAAAT------------------TTTTTATTGCCAAGTAAAATGATTACACCGTTATCAAAAACTGTTCTT---CACCAAACTGTTGCAGTGCATTTGCATGTATATTATCCAGAATTACTTGAAGAATTTTTAGACGCCTTTAAAAACTTTTCGTTTGATTATGATTTGTATCTAACAACTAATACAGATGAAAAAGAAGAAATTATTAAAGAAATG---TTA---AAGTGTAAGGAT---GCCAAGGCTAAGCTTGTCAGGACA---CCTAATCATGGGCGTGATATAGTGCCGTTTTTA---GCACTTAAAGAAGAATTA------AAAAAATATGATATTGTTGGTCATTTTCATACAAAGCGCTCCTTAGAGGCTGCCTTTTTTGCAGGGGAATCTTGGAGAACTGAGTTAATATCAATGTTGATTGAACCT---------GCTGATAACATTATGGCACATTTTGAGCAAAAACAAAAATTAGGAATCGTGATTGCTGATATTCCAAGTTTCTTTAGGTTTAACAAAATTGTCAATGCTGACAATGAAAATAAAcagATTGCTCCTATTATGAATGATATCTGGAAAAGAATGAAAATGAATAAGAAAGTCAATTTTCATGATTTTAATACATTTACAATGAGTTATGGGACATTTTTTTGGGCTAAAATAGAAGTTCTTGAACCTTTATTTAATTTAGAAATAATGGATCGAGAAATTCCAAATGAACCC---CTGCCCCAAAATACAATTTTGCATGCGATTGAACGGGTGCTAATTTATCTTGCATGGGACAAAGAAATG
TRN  10010101100011000
NAM  O82878_STRMU/34-515
ASQ  VIFISNSQVADADVKMLREKHLIDDFIQRQNSGFDFAAWRDGMVFVGFDELVTYDSVTTMNDTCFGPLWEMYSIYQEFETKTTVDFWGLTNNRA------.--TKSFREHIQSYFISFKASVLRSTAFRDFWENIKEYQDVQKVIDQYETKVTTTLLDAGFQYDVVFDTTKEDASH--MLHADFSYYNPTAILNHRVPFIKVKAIDNNQH--ITPYLLNDIQKNSTYPIDLIVSHMSEINYP-DFS------YLLGHKYVKKRERVDLKNQKVAVHLHVFYVDLLEEFLTAFKQFHFSYDLFITTDSDDKKAEIEEI-L-SANG-QEAQVFVT-GNIGRDVLPML-KLKNYL--SAYDFVGHFHTKKSKEADFWAGQSWREELIDMLVKP---ADNILAQLQQNPKIGLVIADMPTFFRYNKIVDAWNEHL.IAPEMNTLWQKMGMTKKIDFNAFHTFVMSYGTFVWFKYDALKPLFDLNLTDDDVPEEP-LPQNSILHAIERLLIYIAWNEHY
DSQ  GTTATCTTTATTTCAAATAGCCAAGTGGCAGATGCGGATGTCAAAATGCTAAGAGAAAAGCATCTCATTGATGACTTCATTCAACGGCAGAATTCTGGATTTGACTTTGCAGCTTGGCGAGATGGAATGGTCTTTGTCGGTTTTGATGAACTTGTGACATATGACTCGGTAACAACCATGAATGACACTTGTTTTGGACCTCTTTGGGAAATGTATTCAATTTATCAAGAATTTGAAACCAAGACGACAGTTGATTTTTGGGGATTGACCAACAACCGTGCG------------------...------ACCAAGTCATTTCGTGAGCATATTCAAAGTTACTTTATTTCATTTAAAGCATCTGTTTTAAGAAGCACCGCTTTCAGAGACTTTTGGGAAAATATAAAAGAGTATCAGGATGTTCAAAAGGTGATTGACCAGTATGAAACAAAAGTCACGACAACTCTCTTAGATGCTGGTTTTCAATATGATGTCGTTTTTGATACGACCAAGGAAGATGCTTCGCAT------ATGCTTCATGCAGACTTCTCTTACTATAATCCAACAGCTATTTTGAATCATAGGGTGCCCTTTATCAAGGTTAAAGCGATTGACAATAATCAACAT------ATTACGCCCTATCTTTTAAATGATATTCAAAAGAATTCGACCTATCCTATTGATTTAATTGTTTCGCATATGTCAGAAATCAATTATCCT---GATTTTAGT------------------TATTTATTGGGTCACAAATATGTCAAGAAAAGAGAAAGAGTTGATTTAAAGAATCAAAAAGTTGCGGTTCATCTCCATGTGTTTTATGTGGATTTACTGGAAGAATTTTTAACGGCATTTAAGCAATTTCATTTTTCTTATGATTTATTTATAACGACAGATAGTGATGATAAGAAAGCTGAAATTGAAGAGATT---CTA---TCCGCAAACGGT---CAAGAAGCTCAGGTTTTTGTCACA---GGCAATATTGGACGTGATGTTCTTCCTATGTTA---AAATTAAAAAATTATTTA------TCTGCCTATGATTTTGTTGGTCATTTTCATACCAAAAAGTCAAAGGAGGCTGATTTTTGGGCTGGCCAATCTTGGCGGGAAGAATTAATTGATATGTTGGTTAAACCA---------GCAGACAATATTTTAGCGCAATTACAGCAAAACCCAAAAATTGGTTTGGTGATTGCTGATATGCCAACTTTCTTTCGCTATAATAAAATTGTTGATGCTTGGAATGAACATTTG...ATTGCACCTGAGATGAATACATTATGGCAAAAGATGGGCATGACCAAAAAGATTGATTTCAATGCTTTTCATACTTTTGTCATGAGTTATGGTACTTTTGTTTGGTTTAAATATGATGCCTTAAAACCGCTCTTTGATTTAAATCTGACAGATGATGATGTGCCTGAGGAACCT---TTACCGCAAAATTCTATTTTACATGCTATTGAGCGTTTGCTGATCTACATTGCTTGGAATGAGCATTAC
TRN  10010101100011000
NAM  Q9A0G0_STRPY/34-514
ASQ  IVFISNSKVSHEDLKRLKNHCLIDEFLQRKNKGFDFSAWHDGLIIMGFDKLEEFDSLTIMNDTCFGPIWEMAPYFENFEEKETVDFWGITNNRG------.--TKAFKEHVQSYFMTFKNQVIQNKVFQQFWQSIIEYENVQEVIQHYETQLTSILLNEGFSYQTVFDTRKAESSF--MPHPDFSYYNPTAILKHHVPFIKVKAIDANQH--IAPYLLNLIRETTNYPIDLIVSHMSQISLP-DT------KYLLSQKYLNCQRLAKQTCQKVAVHLHVFYVDLLDEFLTAFENWNFHYDLFITTDSDIKRKEIKEI-L-QRKG-KTADIRVT-GNRGRDIYPML-LLKDKL--SQYDYIGHFHTKKSKEADFWAGESWRKELIDMLVKP---ADSILSAFETDD-IGIIIADIPSFFRFNKIVNAWNEHL.IAQEMMSLWRKMDVKKQIDFQAMDTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEP-LPQNSILHAIERLLVYIAWGDSY
DSQ  ATTGTTTTTATCTCAAATAGTAAAGTGAGTCACGAAGATTTAAAACGTCTCAAAAACCACTGTCTTATTGATGAGTTTTTGCAACGCAAAAATAAAGGTTTTGATTTTTCTGCATGGCACGATGGCTTGATTATTATGGGATTTGACAAGTTGGAAGAGTTTGACTCATTGACGATTATGAACGATACTTGTTTTGGTCCTATTTGGGAGATGGCTCCTTATTTTGAAAATTTTGAAGAAAAAGAGACAGTTGACTTTTGGGGAATTACTAATAATAGAGGT------------------...------ACAAAAGCTTTTAAAGAACATGTCCAAAGTTATTTTATGACGTTTAAAAATCAAGTCATTCAAAACAAAGTTTTTCAACAATTTTGGCAATCGATAATAGAATATGAAAACGTTCAAGAAGTGATTCAGCATTATGAAACGCAATTAACATCCATTCTCTTAAATGAAGGCTTTAGTTATCAGACGGTCTTTGATACTAGAAAAGCTGAGTCGTCATTC------ATGCCACATCCGGATTTTTCATATTATAATCCAACAGCAATTTTAAAACACCATGTGCCTTTTATAAAAGTAAAAGCTATTGATGCTAACCAGCAT------ATCGCTCCTTACTTATTGAATCTGATACGAGAAACAACCAATTATCCTATAGATCTTATTGTTTCACATATGTCGCAAATCTCTTTGCCA---GATACT------------------AAGTACCTTTTATCTCAAAAATACCTAAACTGCCAACGGTTAGCAAAACAAACTTGTCAAAAGGTAGCTGTTCATTTACATGTTTTTTACGTTGATTTGCTAGATGAATTTTTAACAGCTTTCGAAAACTGGAACTTCCATTATGATCTTTTTATTACAACAGATAGTGATATCAAAAGAAAAGAGATCAAAGAAATA---CTT---CAAAGAAAAGGT---AAAACTGCTGATATACGCGTTACG---GGAAATAGAGGAAGAGATATTTATCCAATGTTA---TTACTAAAAGATAAACTT------TCTCAATATGATTATATTGGTCATTTCCATACGAAAAAATCAAAAGAAGCTGATTTTTGGGCAGGAGAATCTTGGCGAAAAGAATTGATTGATATGCTCGTGAAACCA---------GCAGATAGTATTCTTAGCGCTTTTGAGACAGATGAT---ATTGGTATTATAATCGCAGATATTCCAAGTTTTTTTAGATTTAATAAGATTGTCAATGCTTGGAATGAGCATTTA...ATCGCTCAAGAAATGATGTCTTTGTGGAGAAAAATGGATGTTAAAAAACAAATTGATTTTCAAGCTATGGATACATTTGTTATGAGTTATGGAACATTTGTATGGTTTAAATACGATGCTCTAAAATCACTTTTTGATTTAGAATTAACTCAAAATGATATTCCAAGTGAACCT---TTACCACAAAACTCTATATTACATGCGATTGAGCGGTTACTTGTCTATATAGCGTGGGGGGATTCTTAT
TRN  10010101100011000
//