EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF05019 - Coq4)
FAM  PF05019
PID  Coq4
DES  Coenzyme Q (ubiquinone) biosynthesis protein Coq4
IPR  IPR007715
ANO  5
ALN  220
AID  0.402826
APH  ((COQ4_CAEEL/8-226:0.57795,(COQ4_ARATH/5-220:0.68264,COQ4_HUMAN/39-256:0.39832):0.08645):0.23683,COQ4_YEAST/85-303:0.52095,COQ4_SCHPO/48-267:0.41423);
ATP  ((COQ4_CAEEL/8-226,(COQ4_ARATH/5-220,COQ4_HUMAN/39-256)),COQ4_YEAST/85-303,COQ4_SCHPO/48-267);
ATL  2.91738
DNO  5
DLN  660
DID  0.469846
DPH  ((COQ4_YEAST/85-303:0.38342,COQ4_SCHPO/48-267:0.41471):0.15713,(COQ4_CAEEL/8-226:0.42212,COQ4_ARATH/5-220:0.52144):0.08020,COQ4_HUMAN/39-256:0.44705);
DTP  ((COQ4_YEAST/85-303,COQ4_SCHPO/48-267),(COQ4_CAEEL/8-226,COQ4_ARATH/5-220),COQ4_HUMAN/39-256);
DTL  2.42607
RID  0.402826
RPH  ((COQ4_CAEEL/8-226:0.57795,(COQ4_ARATH/5-220:0.68264,COQ4_HUMAN/39-256:0.39832):0.08645):0.23683,COQ4_YEAST/85-303:0.52095,COQ4_SCHPO/48-267:0.41423);
RTP  ((COQ4_CAEEL/8-226,(COQ4_ARATH/5-220,COQ4_HUMAN/39-256)),COQ4_YEAST/85-303,COQ4_SCHPO/48-267);
RTL  2.91738
LNK  COQ4_ARATH/5-220:Q9ZPR0:AC006836
LNK  COQ4_CAEEL/8-226:P91428:U88169
LNK  COQ4_HUMAN/39-256:Q9Y3A0:BC011895
LNK  COQ4_SCHPO/48-267:O94453:AL035064
LNK  COQ4_YEAST/85-303:O13525:AF005742
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  COQ4_SCHPO/48-267
ASQ  PGHVPLSPLQRIFLVAGSAIMGLKAPWRGGDMISVLGDASGQPFFLHRLLNKMLVDKTGREILKDKPRMTSKSLNLPFLRTLPPNTLGKIYVDWIDKEHVGPDTRSPTRFVDDPEEAYVMQRYRESHDFYHAICNMPTNIEGELAIKWLEFVNMGLPVGALSALFGPLRLNCEQASRFRRVYIPWSIRNGLNAKTLINVYWEKELTNDIEDVRRRIRIEA
DSQ  CCAGGACATGTTCCTTTATCACCGCTGCAACGTATTTTTTTGGTTGCAGGATCAGCAATCATGGGATTGAAGGCACCATGGAGAGGCGGAGATATGATATCTGTCCTAGGAGATGCATCTGGTCAACCATTCTTCCTTCATCGATTACTGAATAAAATGCTCGTTGATAAAACAGGTCGTGAAATTTTGAAAGATAAACCTAGAATGACATCGAAGTCTTTAAACTTACCATTTTTGCGGACCCTTCCGCCAAATACCCTAGGTAAAATTTATGTTGACTGGATAGACAAAGAGCATGTTGGACCCGATACTCGAAGCCCTACCCGTTTTGTAGATGACCCAGAGGAGGCATATGTTATGCAAAGATATCGTGAATCTCACGATTTTTACCATGCTATATGTAACATGCCTACAAACATTGAAGGAGAATTAGCTATTAAATGGCTGGAATTTGTTAACATGGGTTTACCAGTTGGAGCTCTCTCTGCTTTATTTGGTCCTCTACGCTTAAATTGTGAACAGGCTTCAAGGTTTCGTCGGGTATACATTCCATGGTCGATTCGTAATGGTTTGAATGCAAAAACATTGATCAATGTCTATTGGGAAAAGGAACTGACGAACGACATTGAGGACGTCCGTAGACGAATACGAATTGAGGCT
TRN  10010101100011000
NAM  COQ4_YEAST/85-303
ASQ  NGHVPLHRYEKLLLFAISGWNSFFHPEDGYNIVQ-LGEATALPVFLENLKQTMLSDSSGRRILKEQPNITTEILHMDKLAKLPHNTFGYVYYQWLKRENVSPDTRAPVKFIDDPMHAYIFKRYRQCHDFYHAITNMPIIIEGEITIKALEGANLGVPMAILGGILAPLRLKKVQRKRLYNIYLPWAVRTGLSCKPLINVYWEEMLEKDVTALRKELKITL
DSQ  AACGGCCATGTTCCCCTTCATCGGTACGAGAAATTGCTGCTGTTTGCAATTTCCGGTTGGAATTCATTTTTCCATCCTGAAGATGGTTATAATATTGTACAA---TTGGGTGAGGCAACTGCATTGCCGGTCTTCTTGGAGAATTTGAAGCAAACAATGTTAAGTGATTCCTCTGGGAGGCGCATTTTGAAGGAACAACCCAATATCACAACAGAGATTTTGCATATGGACAAACTAGCTAAATTGCCACATAACACGTTTGGGTATGTATATTACCAATGGTTGAAAAGAGAAAACGTTTCTCCGGACACTAGAGCACCTGTCAAATTTATCGACGATCCTATGCATGCATATATCTTTAAGAGGTATAGACAATGCCACGATTTCTATCACGCTATAACCAACATGCCTATTATCATTGAGGGGGAGATCACCATAAAGGCTCTTGAAGGTGCCAACCTGGGCGTCCCAATGGCCATTCTCGGTGGTATCCTTGCACCTTTACGTTTGAAAAAGGTGCAAAGAAAAAGATTATATAATATATATCTCCCTTGGGCTGTCAGAACAGGTTTAAGCTGCAAGCCATTGATCAACGTGTATTGGGAGGAAATGCTGGAGAAGGATGTTACTGCTTTGAGGAAAGAGCTAAAGATAACACTC
TRN  10010101100011000
NAM  COQ4_CAEEL/8-226
ASQ  ASHVPLAPLSRMLLGIGSAVTAISDP-KRGDMVAAMGETTAIGPVLENIRKRMESDVVGKRLLLEKPRISNGTIDRKWLRQLPDGTLGKLYSNFLDRLNTSPDARPTVKYIDNLEHLYVMQRYRETHDFTHIALEQKTNMLGEVTVKYFEGIQYGLPMCVTGGIFGGARLLTKNRQELVDRNLPWVVEQATNARFFMAFDWENHFEKQLSEVQKELNITP
DSQ  GCATCGCATGTTCCCTTGGCACCGCTGTCTCGGATGCTTCTCGGGATTGGATCAGCAGTAACAGCGATCTCGGATCCA---AAAAGAGGAGATATGGTGGCAGCGATGGGCGAAACTACTGCAATTGGACCAGTTTTAGAAAATATTCGAAAAAGAATGGAATCTGATGTTGTTGGAAAGCGACTTCTTCTCGAAAAACCAAGAATTTCAAATGGAACAATTGATAGAAAGTGGCTAAGACAGTTACCGGATGGAACATTAGGAAAATTGTATTCAAACTTTCTCGATCGTTTGAACACATCTCCAGATGCTCGGCCCACTGTCAAGTATATCGATAATTTGGAGCATCTTTATGTTATGCAAAGGTATCGCGAAACACACGACTTCACCCACATCGCATTGGAGCAGAAAACGAACATGCTCGGCGAGGTAACAGTCAAATATTTCGAAGGAATTCAATATGGGCTTCCAATGTGTGTCACTGGTGGAATATTTGGAGGTGCCAGGCTTTTAACAAAAAATCGCCAAGAACTTGTCGACCGGAACCTCCCTTGGGTTGTGGAGCAGGCCACGAATGCACGATTCTTCATGGCTTTCGACTGGGAAAATCACTTTGAAAAGCAGCTCAGCGAGGTGCAGAAGGAGCTAAATATAACGCCA
TRN  10010101100011000
NAM  COQ4_HUMAN/39-256
ASQ  SHHLPTSPLQKALLAAGSAAMALYNP-YRHDMVAVLGETTGH-RTLKVLRDQMRRDPEGAQILQERPRISTSTLDLGKLQSLPEGSLGREYLRFLDVNRVSPDTRAPTRFVDDEELAYVIQRYREVHDMLHTLLGMPTNILGEIVVKWFEAVQTGLPMCILGAFFGPIRLGAQSLQVLVSELIPWAVQNGRRAPCVLNLYYERRWEQSLRALREELGITA
DSQ  TCGCACCACCTCCCCACCTCCCCGCTGCAGAAAGCGCTGTTGGCCGCCGGCTCCGCGGCGATGGCGCTCTATAACCCC---TACCGCCACGACATGGTCGCAGTTCTAGGGGAGACCACAGGACAC---CGCACCCTGAAGGTCCTCAGGGACCAGATGAGGAGGGATCCAGAGGGTGCCCAGATCCTGCAGGAGCGTCCCCGGATTTCGACATCCACCCTCGACCTGGGCAAGCTCCAGAGCCTGCCGGAAGGCTCCCTCGGTCGCGAGTATCTCCGTTTCCTGGATGTGAACAGGGTCTCCCCAGACACCCGAGCACCCACCCGCTTCGTGGATGATGAGGAGCTAGCGTATGTGATTCAGCGGTACCGGGAGGTGCACGACATGCTTCACACCCTGCTGGGGATGCCCACCAACATCCTGGGGGAGATCGTGGTGAAATGGTTTGAGGCTGTCCAGACTGGCCTGCCCATGTGCATCCTGGGTGCATTCTTTGGACCGATCCGACTTGGCGCTCAGAGCCTGCAAGTGCTGGTCTCGGAGTTGATCCCATGGGCCGTTCAGAACGGGCGCAGAGCCCCATGTGTCCTCAACCTGTACTATGAGCGGCGCTGGGAGCAGTCCCTGAGGGCTCTGCGGGAGGAGCTGGGCATTACAGCA
TRN  10010101100011011
NAM  COQ4_ARATH/5-220
ASQ  RARVPLSRWQQAAVAMGSALGALVDP-RRADLIAALGETTGK-PAFEMVLERMKKSEEGRAILLERPRVVSEQVG--HAWDLPENTFGAAYAKFMGSRNFSPDDRPPVRFMETDELAYVATRAREVHDLWHTLFGLPTNLIGESSLKVIEFEQMYLPMCMLSVIGGTVRFNEKQRSMFLKHYLPWAVRAGRQCTDLMCVYYERHFSEDLEQVRRKWGIIP
DSQ  AGAGCTCGAGTTCCGTTGAGCCGATGGCAACAAGCGGCCGTGGCGATGGGATCTGCTCTCGGTGCGTTGGTTGATCCT---CGTAGAGCGGATCTAATCGCTGCTCTCGGCGAAACTACCGGTAAA---CCAGCTTTTGAAATGGTTCTTGAGAGAATGAAGAAGAGCGAAGAAGGAAGAGCTATATTATTGGAGCGTCCTCGAGTTGTGTCAGAGCAAGTAGGT------CATGCTTGGGATCTACCAGAAAACACATTTGGAGCTGCATATGCTAAATTCATGGGATCTAGAAACTTCTCTCCCGATGATCGTCCGCCCGTAAGATTCATGGAGACGGATGAATTGGCTTACGTAGCGACACGGGCACGCGAAGTTCACGACTTATGGCACACTCTGTTTGGCCTTCCTACGAATCTTATCGGCGAGTCGTCTTTGAAAGTTATCGAGTTTGAGCAAATGTATCTTCCGATGTGTATGCTCTCTGTGATTGGAGGTACTGTGAGGTTCAACGAGAAGCAAAGATCAATGTTCTTGAAGCATTACCTTCCTTGGGCTGTTCGTGCTGGAAGACAATGCACTGACCTCATGTGTGTGTACTATGAGCGTCACTTTAGTGAAGACTTGGAGCAAGTTCGTAGAAAATGGGGAATCATCCCT
TRN  10010101100011000
//