EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04999 - FtsL)
FAM  PF04999
PID  FtsL
DES  Cell division protein FtsL
IPR  IPR007082
ANO  7
ALN  97
AID  0.380307
APH  (((Q9KPG0_VIBCH/9-105:0.19263,Q9AJG8_VIBPR/8-104:0.10583):0.26673,(FTSL_ECOLI/24-120:0.43697,(Q9CPB3_PASMU/11-106:0.26187,FTSL_HAEIN/11-107:0.31493):0.47234):0.19224):0.17434,Q9HVZ6_PSEAE/1-97:1.14279,Q9F1N7_SHEVI/8-103:0.62189);
ATP  (((Q9KPG0_VIBCH/9-105,Q9AJG8_VIBPR/8-104),(FTSL_ECOLI/24-120,(Q9CPB3_PASMU/11-106,FTSL_HAEIN/11-107))),Q9HVZ6_PSEAE/1-97,Q9F1N7_SHEVI/8-103);
ATL  4.18256
DNO  7
DLN  291
DID  0.4732
DPH  ((((Q9F1N7_SHEVI/8-103:0.45717,Q9HVZ6_PSEAE/1-97:0.64204):0.06022,FTSL_ECOLI/24-120:0.34497):0.17218,(Q9AJG8_VIBPR/8-104:0.21513,Q9KPG0_VIBCH/9-105:0.20584):0.13710):0.35804,FTSL_HAEIN/11-107:0.28006,Q9CPB3_PASMU/11-106:0.27743);
DTP  ((((Q9F1N7_SHEVI/8-103,Q9HVZ6_PSEAE/1-97),FTSL_ECOLI/24-120),(Q9AJG8_VIBPR/8-104,Q9KPG0_VIBCH/9-105)),FTSL_HAEIN/11-107,Q9CPB3_PASMU/11-106);
DTL  3.15018
RID  0.380307
RPH  (((Q9KPG0_VIBCH/9-105:0.19263,Q9AJG8_VIBPR/8-104:0.10583):0.26673,(FTSL_ECOLI/24-120:0.43697,(Q9CPB3_PASMU/11-106:0.26187,FTSL_HAEIN/11-107:0.31493):0.47234):0.19224):0.17434,Q9HVZ6_PSEAE/1-97:1.14279,Q9F1N7_SHEVI/8-103:0.62189);
RTP  (((Q9KPG0_VIBCH/9-105,Q9AJG8_VIBPR/8-104),(FTSL_ECOLI/24-120,(Q9CPB3_PASMU/11-106,FTSL_HAEIN/11-107))),Q9HVZ6_PSEAE/1-97,Q9F1N7_SHEVI/8-103);
RTL  4.18256
LNK  FTSL_ECOLI/24-120:P22187:S49875
LNK  FTSL_HAEIN/11-107:P45058:U32793
LNK  Q9AJG8_VIBPR/8-104:Q9AJG8:AB047585
LNK  Q9CPB3_PASMU/11-106:Q9CPB3:AE006048
LNK  Q9F1N7_SHEVI/8-103:Q9F1N7:AB052554
LNK  Q9HVZ6_PSEAE/1-97:Q9HVZ6:AE004856
LNK  Q9KPG0_VIBCH/9-105:Q9KPG0:AE004310
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9F1N7_SHEVI/8-103
ASQ  LIRIILADLWH-QKWILLLAMAVVANGITIVYTSYVSRKYISQWDQMWEERDRLDIEWRNLLLEEQSQSEHSRITRIASKQLDMSRPLPKEEIVVRI
DSQ  CTCATTCGAATTATCTTAGCCGATCTTTGGCAT---CAAAAGTGGATATTACTGCTTGCGATGGCCGTGGTCGCTAATGGGATCACCATTGTATATACAAGCTATGTTAGCCGTAAATATATTAGCCAATGGGATCAGATGTGGGAGGAAAGAGATAGGTTAGATATCGAATGGCGAAACCTATTGCTTGAAGAGCAATCTCAGTCTGAACATAGCCGAATTACCCGCATTGCGAGTAAGCAGTTAGACATGAGTCGGCCCTTACCTAAGGAAGAGATCGTGGTGAGGATA
TRN  10010101100011010
NAM  Q9KPG0_VIBCH/9-105
ASQ  LAKLIALDLLTVGRVPLLLLVLIFSCAMGVVFMTHHTRQAISAKDQAFMERERLDNEWRNLILEETALAEHSRVQQLARKDLEMKRPDSDKEVVINL
DSQ  CTCGCGAAGTTAATTGCCCTCGATCTACTGACGGTAGGTCGGGTGCCCTTGCTGCTTTTAGTGCTGATTTTTAGCTGCGCTATGGGCGTGGTGTTTATGACTCACCATACTAGACAGGCGATCAGTGCTAAAGATCAAGCCTTTATGGAGCGTGAGCGGCTCGATAACGAATGGCGCAACCTGATTTTGGAAGAAACTGCTTTGGCTGAGCACAGCCGAGTACAACAATTAGCAAGAAAAGATCTGGAGATGAAACGTCCAGATTCAGACAAAGAAGTCGTGATCAACCTT
TRN  10010101100011000
NAM  Q9AJG8_VIBPR/8-104
ASQ  LAKLIGADLLTVGRIPMLLLILIFASAMGVVFMTHHTREAISEKDVAQAERERLDNEWRNLLLEETALAEHSRVQSVAKDELDMQRPDSEKEVIVTL
DSQ  CTGGCCAAATTGATTGGAGCGGATCTGCTGACCGTGGGTCGCATCCCGATGTTACTGCTGATATTGATTTTCGCCAGCGCCATGGGCGTTGTGTTTATGACCCACCACACCCGAGAGGCCATTTCAGAAAAAGACGTGGCGCAGGCTGAACGTGAACGACTTGATAACGAGTGGCGTAACCTGTTGCTAGAAGAAACCGCTCTGGCGGAGCACAGCCGGGTGCAGTCTGTGGCCAAAGACGAGCTGGATATGCAACGTCCGGATTCCGAGAAAGAAGTGATCGTGACGCTA
TRN  10010101100011000
NAM  FTSL_ECOLI/24-120
ASQ  LPGVIGDDLLRFGKLPLCLFICIILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEKLQMQHVDPSQENIVVQ
DSQ  TTGCCTGGTGTTATCGGTGACGATCTTTTGCGATTTGGGAAGCTGCCACTCTGCCTGTTCATTTGCATTATTTTGACGGCGGTGACTGTGGTAACCACGGCGCACCATACCCGTTTACTGACCGCTCAGCGCGAACAACTGGTGCTGGAGCGAGATGCTTTAGACATTGAATGGCGCAACCTGATCCTTGAAGAGAATGCGCTCGGCGACCATAGCCGGGTGGAAAGGATCGCCACGGAAAAGCTGCAAATGCAGCATGTTGATCCGTCACAAGAAAATATCGTAGTGCAA
TRN  10010101100011000
NAM  Q9CPB3_PASMU/11-106
ASQ  LQNIILDDLFSANKTIIALLFLIVMTALGTIWITHQTRILVAENGQLVLEHQALENEYLNLKLEEATQSDNTRIEAIAR-QLGMKRVEPEQEVLILE
DSQ  TTACAAAATATTATTTTAGATGATTTGTTTAGTGCTAATAAAACTATCATTGCTTTATTATTTTTGATTGTGATGACTGCATTGGGCACTATTTGGATTACGCATCAGACCCGAATTTTAGTGGCAGAAAATGGTCAGCTCGTGCTTGAGCATCAAGCGCTTGAGAATGAATATTTAAATTTGAAATTAGAAGAAGCCACGCAAAGTGATAATACCCGCATTGAAGCCATTGCACGC---CAATTAGGGATGAAGCGCGTTGAGCCAGAACAAGAAGTGTTGATCCTAGAG
TRN  11011101111011010
NAM  FTSL_HAEIN/11-107
ASQ  LQQILVEDLFSSNKLVVLLLIGILVSAMGTIWITHKTRQLISENGMLILQRQALENEYRNLQVQEATEGDSTRVESIAISTLKMKVVSSEQEVEIRE
DSQ  TTACAGCAGATTTTAGTCGAAGATTTATTTTCTTCAAATAAGTTAGTGGTGTTGCTGTTAATAGGGATTTTAGTTTCTGCAATGGGGACGATTTGGATAACCCATAAAACTCGCCAATTAATTTCTGAAAATGGAATGTTAATTTTACAGCGTCAAGCACTTGAGAATGAATACCGTAATTTACAAGTGCAGGAAGCTACGGAAGGGGATAGCACGCGAGTAGAATCTATTGCGATTAGTACATTAAAAATGAAAGTTGTTTCTTCAGAGCAAGAAGTTGAAATTAGAGAA
TRN  10010101100011000
NAM  Q9HVZ6_PSEAE/1-97
ASQ  MSRLFVKRLPTGSFLMLLLYIGLLLSAIAVAYSTYWNRQLLNSLYSELSVRDKAQAEWGRLILEQSTWTAHSRIESLAVEQLRMRVPDPAEVRMVAP
DSQ  ATGAGCCGTCTCTTCGTCAAGCGCCTGCCTACCGGCAGCTTCCTCATGTTGCTGCTTTATATAGGTCTGCTGCTCTCGGCGATTGCCGTGGCCTACAGCACCTACTGGAACCGGCAACTGCTCAACTCGCTGTATTCCGAGCTGAGCGTGCGCGACAAGGCGCAGGCCGAGTGGGGCCGGTTGATTCTCGAGCAGAGCACCTGGACCGCCCATAGCCGCATCGAAAGCCTGGCGGTGGAACAGTTGCGCATGCGCGTTCCCGACCCGGCCGAGGTCAGGATGGTGGCGCCA
TRN  10010101100011011
//