EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04994 - TfoX_C)
FAM  PF04994
PID  TfoX_C
DES  TfoX C-terminal domain
IPR  IPR007077
ANO  6
ALN  82
AID  0.339519
APH  (((Q9KSV3_VIBCH/118-199:0.38351,YCCR_ECOLI/115-195:0.87110):0.15588,(Q9HV94_PSEAE/1-81:1.22466,Q9KRC0_VIBCH/114-195:0.16148):0.29596):0.49586,Q9CKP8_PASMU/118-198:0.28947,TFOX_HAEIN/119-199:0.55222);
ATP  (((Q9KSV3_VIBCH/118-199,YCCR_ECOLI/115-195),(Q9HV94_PSEAE/1-81,Q9KRC0_VIBCH/114-195)),Q9CKP8_PASMU/118-198,TFOX_HAEIN/119-199);
ATL  4.43013
DNO  6
DLN  246
DID  0.427027
DPH  ((YCCR_ECOLI/115-195:0.55593,(Q9CKP8_PASMU/118-198:0.24168,TFOX_HAEIN/119-199:0.46006):0.32602):0.11700,(Q9KRC0_VIBCH/114-195:0.24320,Q9HV94_PSEAE/1-81:0.85853):0.22127,Q9KSV3_VIBCH/118-199:0.36073);
DTP  ((YCCR_ECOLI/115-195,(Q9CKP8_PASMU/118-198,TFOX_HAEIN/119-199)),(Q9KRC0_VIBCH/114-195,Q9HV94_PSEAE/1-81),Q9KSV3_VIBCH/118-199);
DTL  3.38442
RID  0.339519
RPH  (((Q9KSV3_VIBCH/118-199:0.38351,YCCR_ECOLI/115-195:0.87110):0.15588,(Q9HV94_PSEAE/1-81:1.22466,Q9KRC0_VIBCH/114-195:0.16148):0.29596):0.49586,Q9CKP8_PASMU/118-198:0.28947,TFOX_HAEIN/119-199:0.55222);
RTP  (((Q9KSV3_VIBCH/118-199,YCCR_ECOLI/115-195),(Q9HV94_PSEAE/1-81,Q9KRC0_VIBCH/114-195)),Q9CKP8_PASMU/118-198,TFOX_HAEIN/119-199);
RTL  4.43013
LNK  Q9CKP8_PASMU/118-198:Q9CKP8:AE006192
LNK  Q9HV94_PSEAE/1-81:Q9HV94:AE004884
LNK  Q9KRC0_VIBCH/114-195:Q9KRC0:AE004250
LNK  Q9KSV3_VIBCH/118-199:Q9KSV3:AE004195
LNK  TFOX_HAEIN/119-199:P43779:U13205
LNK  YCCR_ECOLI/115-195:P75869:U00096
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  TFOX_HAEIN/119-199
ASQ  KLNRLKDLPNLTIKHERALIKVGITNVAMLREIGAENALVELKKS-GSGATLDFYWKLVCALQNKNSQMLSQAEKERLLKKL
DSQ  AAATTGAATCGATTAAAGGATTTACCCAATTTAACGATTAAACATGAAAGAGCTTTAATAAAAGTTGGTATTACAAATGTTGCGATGCTAAGAGAGATTGGCGCAGAAAATGCATTGGTGGAATTAAAGAAAAGT---GGCAGTGGTGCTACGCTTGATTTTTATTGGAAATTAGTATGTGCTTTGCAAAATAAAAATAGTCAGATGTTAAGTCAAGCTGAAAAAGAGCGTTTATTGAAGAAATTA
TRN  10010101110011010
NAM  Q9CKP8_PASMU/118-198
ASQ  KKNRIKELPNLSIKHERLLEKVEIHDVATFQALGAKNAYIRLKKK-GITADIGIFWAFHAALENKNVNLITVAEKQQLLVHL
DSQ  AAGAAAAATCGCATTAAAGAGTTGCCTAACTTATCGATTAAACATGAACGATTATTAGAAAAAGTGGAAATTCATGATGTTGCCACTTTCCAGGCATTAGGTGCAAAGAATGCTTACATTCGTTTAAAAAAGAAA---GGGATTACTGCCGATATTGGCATCTTCTGGGCATTTCATGCTGCACTAGAAAATAAAAATGTCAATTTAATCACTGTGGCAGAAAAACAACAGCTTTTAGTGCATCTT
TRN  11011101111011010
NAM  Q9KSV3_VIBCH/118-199
ASQ  ASRRLRDLPNMQLTLERMVKKAGIDDVETFMSLGAPEVFNKVRQAYGSDVDVKLLWKFAGAIEGIHWKLLQEPRKRQLLESC
DSQ  GCCAGTCGTCGTCTACGGGATTTACCCAATATGCAACTGACTTTGGAGCGTATGGTAAAAAAAGCGGGCATTGACGATGTGGAAACTTTTATGAGCCTCGGTGCGCCAGAAGTGTTTAATAAGGTGCGTCAAGCTTATGGAAGTGATGTCGATGTAAAACTACTGTGGAAGTTTGCGGGTGCGATTGAAGGCATTCACTGGAAACTGCTGCAAGAGCCGCGTAAGCGCCAACTGTTAGAAAGTTGT
TRN  11011101101011010
NAM  Q9KRC0_VIBCH/114-195
ASQ  KPDRLKDLPNLRLATERMLKKAGIDTVESLQTLGSVEAYKAVQRTHTAEVSLELLWALEGAIEGKHWSVIPQNRRDELLRHL
DSQ  AAACCTGATCGTTTGAAAGATCTTCCTAACTTGCGTTTAGCAACAGAAAGAATGCTCAAAAAAGCAGGTATCGACACCGTCGAGTCTCTTCAGACTCTTGGTTCTGTCGAAGCTTATAAAGCGGTTCAACGAACCCACACGGCAGAGGTGAGTTTAGAGTTGCTATGGGCTCTAGAAGGCGCAATCGAAGGTAAACATTGGTCGGTGATCCCACAAAATCGTCGTGATGAGCTATTAAGGCATCTC
TRN  10010101110011010
NAM  YCCR_ECOLI/115-195
ASQ  TRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQ-NSLVTEKILFMLEGAIIGIHEAALPVARRQELAEWA
DSQ  ACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCGGGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAA---AACAGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACGCCGCCAGGAGCTTGCAGAATGGGCT
TRN  10010101100011010
NAM  Q9HV94_PSEAE/1-81
ASQ  MNDELLNLKNLGKTSTQWLHAVGIHSATDLRRLGSVGAYRAVRAR-GFRASKVLLYAIEGALLDVHWNELSPDHKAALLGEL
DSQ  ATGAACGACGAACTGCTGAACCTGAAAAACCTCGGGAAAACCTCGACCCAATGGTTGCATGCCGTGGGTATCCACAGCGCCACCGATCTGCGTCGGCTCGGCTCGGTGGGAGCCTATCGCGCGGTCCGCGCGCGC---GGCTTCCGAGCCTCGAAAGTCTTGCTCTATGCCATCGAAGGCGCACTCCTCGACGTTCACTGGAACGAGCTGTCCCCAGACCACAAGGCCGCACTGCTCGGCGAGCTG
TRN  11011101101011011
//