EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04992 - RNA_pol_Rpb1_6)
FAM  PF04992
PID  RNA_pol_Rpb1_6
DES  RNA polymerase Rpb1, domain 6
IPR  IPR007075
ANO  74
ALN  205
AID  0.482787
APH  (((((((((((((((((((O02452_MASGI/535-718:0.05049,(O02428_DYSCR/53-236:0.15963,O02416_APHCH/53-236:0.03623):0.06253):0.02278,O02450_LIMPO/426-609:0.11293):0.01464,Q9BNE5_9ARAC/45-228:0.11707):0.01130,Q9BNE0_HADAR/35-218:0.07544):0.07590,((Q9BNN8_9MYRI/35-218:0.10028,((Q9BNJ6_9MYRI/51-234:0.03034,Q9BNN0_9MYRI/35-218:0.05071):0.03285,(Q9NJJ7_9MYRI/547-730:0.07529,Q9BNP6_9MYRI/35-218:0.04170):0.04172):0.02825):0.03878,((Q9BNK9_9MYRI/35-218:0.11736,Q9BNL1_9MYRI/35-218:0.00959):0.12230,Q9NJK2_9MYRI/547-730:0.09992):0.01096):0.06040):0.03695,((Q9NJN3_ARMVU/53-236:0.27096,((((Q9XZU9_DROSU/888-1071:0.00000,Q9XZS1_DROGU/888-1071:0.00000):0.00000,Q9XZS2_DROMD/888-1071:0.01090):0.03070,Q9XZU8_DROPS/810-993:0.00909):0.03424,RPB1_DROME/888-1071:0.04720):0.16947):0.05204,(Q9NJJ2_9HEXA/356-539:0.11018,Q17085_ARTSA/808-991:0.18183):0.04375):0.09361):0.05745,((Q9PTX4_LAMRE/395-578:0.18336,Q9U5F6_EPTBU/395-578:0.12560):0.04096,(((RPB1_MOUSE/896-1079:0.00000,O35559_CRIGR/896-1079:0.00549):0.00000,O08847_MOUSE/896-1079:0.00000):0.00000,RPB1_HUMAN/896-1079:0.00000):0.14621):0.16588):0.03320,(Q25203_9CAEN/810-993:0.26550,Q23699_CRAGI/807-990:0.15476):0.11487):0.04541,Q25151_9ANNE/803-986:0.30570):0.14301,(P91819_ZELPU/98-281:0.14385,((((O01376_9BILA/101-284:0.08236,RPB1_CAEEL/886-1069:0.10841):0.15916,P90678_9BILA/101-284:0.14949):0.03310,O01364_9BILA/101-284:0.12338):0.04025,(O01370_9BILA/101-284:0.15861,O01375_9BILA/101-284:0.15213):0.08756):0.00606):0.14673):0.17762,Q9BMP3_MONBE/814-997:0.58857):0.20371,((O00820_ACACA/802-986:0.48643,RPB1_DICDI/57-250:0.52072):0.16345,(Q99368_SOYBN/83-267:0.16149,RPB1_ARATH/893-1077:0.17198):0.36907):0.08613):0.12939,((Q9HGZ5_ASPOR/893-1076:0.59423,RPB1_YEAST/873-1056:0.43981):0.14081,RPB1_SCHPO/879-1059:0.41972):0.05283):0.17991,Q27095_TRIVA/891-1076:0.71186):0.06737,O77165_9EUKA/801-995:1.01913):0.73824,((O15679_LEITA/43-244:0.00502,((O77439_9TRYP/43-244:0.00000,O18713_9TRYP/43-244:0.00000):0.00000,O18710_9TRYP/43-244:0.00000):0.00504):0.00985,(((((((Q25223_LEIAM/43-244:0.00000,(((Q25290_9TRYP/43-244:0.00000,O18712_9TRYP/43-244:0.01017):0.04116,(Q25291_9TRYP/43-244:0.00505,O18711_9TRYP/43-244:0.01013):0.01008):0.01023,((O15678_LEIBR/43-244:0.00509,Q25382_9TRYP/43-244:0.00000):0.00000,Q9GP01_LEIGU/33-232:0.01550):0.02043):0.00507):0.00503,Q9NJR9_LEIDO/852-1054:0.03106):0.00000,(Q9GNZ5_LEIMA/30-230:0.01542,(Q9GNX2_9TRYP/31-232:0.00000,Q9GP03_9TRYP/31-232:0.00000):0.00000):0.01017):0.00000,Q25268_LEIDO/43-244:0.00000):0.00000,Q25312_LEIMA/853-1054:0.00000):0.00000,O15680_LEITR/43-244:0.00000):0.00503,((Q9NJG6_LEIEN/46-247:0.06321,Q9BJ59_LEPSE/851-1052:0.12115):0.00994,Q25311_LEIME/43-244:0.00503):0.00000):0.00529):0.13975):0.23612,RPB1_TRYBB/876-1077:0.00000):0.00000,RPB2_TRYBB/876-1077:0.00000):0.00000,Q26791_9TRYP/875-1076:0.00000,Q26794_9TRYP/875-1076:0.00000);
ATP  (((((((((((((((((((O02452_MASGI/535-718,(O02428_DYSCR/53-236,O02416_APHCH/53-236)),O02450_LIMPO/426-609),Q9BNE5_9ARAC/45-228),Q9BNE0_HADAR/35-218),((Q9BNN8_9MYRI/35-218,((Q9BNJ6_9MYRI/51-234,Q9BNN0_9MYRI/35-218),(Q9NJJ7_9MYRI/547-730,Q9BNP6_9MYRI/35-218))),((Q9BNK9_9MYRI/35-218,Q9BNL1_9MYRI/35-218),Q9NJK2_9MYRI/547-730))),((Q9NJN3_ARMVU/53-236,((((Q9XZU9_DROSU/888-1071,Q9XZS1_DROGU/888-1071),Q9XZS2_DROMD/888-1071),Q9XZU8_DROPS/810-993),RPB1_DROME/888-1071)),(Q9NJJ2_9HEXA/356-539,Q17085_ARTSA/808-991))),((Q9PTX4_LAMRE/395-578,Q9U5F6_EPTBU/395-578),(((RPB1_MOUSE/896-1079,O35559_CRIGR/896-1079),O08847_MOUSE/896-1079),RPB1_HUMAN/896-1079))),(Q25203_9CAEN/810-993,Q23699_CRAGI/807-990)),Q25151_9ANNE/803-986),(P91819_ZELPU/98-281,((((O01376_9BILA/101-284,RPB1_CAEEL/886-1069),P90678_9BILA/101-284),O01364_9BILA/101-284),(O01370_9BILA/101-284,O01375_9BILA/101-284)))),Q9BMP3_MONBE/814-997),((O00820_ACACA/802-986,RPB1_DICDI/57-250),(Q99368_SOYBN/83-267,RPB1_ARATH/893-1077))),((Q9HGZ5_ASPOR/893-1076,RPB1_YEAST/873-1056),RPB1_SCHPO/879-1059)),Q27095_TRIVA/891-1076),O77165_9EUKA/801-995),((O15679_LEITA/43-244,((O77439_9TRYP/43-244,O18713_9TRYP/43-244),O18710_9TRYP/43-244)),(((((((Q25223_LEIAM/43-244,(((Q25290_9TRYP/43-244,O18712_9TRYP/43-244),(Q25291_9TRYP/43-244,O18711_9TRYP/43-244)),((O15678_LEIBR/43-244,Q25382_9TRYP/43-244),Q9GP01_LEIGU/33-232))),Q9NJR9_LEIDO/852-1054),(Q9GNZ5_LEIMA/30-230,(Q9GNX2_9TRYP/31-232,Q9GP03_9TRYP/31-232))),Q25268_LEIDO/43-244),Q25312_LEIMA/853-1054),O15680_LEITR/43-244),((Q9NJG6_LEIEN/46-247,Q9BJ59_LEPSE/851-1052),Q25311_LEIME/43-244)))),RPB1_TRYBB/876-1077),RPB2_TRYBB/876-1077),Q26791_9TRYP/875-1076,Q26794_9TRYP/875-1076);
ATL  14.0794
DNO  56
DLN  615
DID  0.525865
DPH  ((((((((((((((O02450_LIMPO/426-609:0.16224,Q9BNE0_HADAR/35-218:0.10909):0.05373,O02452_MASGI/535-718:0.13848):0.08415,Q9NJN3_ARMVU/53-236:0.29564):0.09427,(Q9BNK9_9MYRI/35-218:0.16333,Q9BNL1_9MYRI/35-218:0.15139):0.05726):0.14500,Q9BNP6_9MYRI/35-218:0.13033):0.10804,((Q25203_9CAEN/810-993:0.27121,(((Q9XZU9_DROSU/888-1071:0.00470,(Q9XZS1_DROGU/888-1071:0.01096,Q9XZS2_DROMD/888-1071:0.00550):0.00076):0.05953,Q9XZU8_DROPS/810-993:0.03602):0.04768,RPB1_DROME/888-1071:0.11083):0.17751):0.05271,(((((RPB1_MOUSE/896-1079:0.00000,O08847_MOUSE/896-1079:0.00000):0.03414,O35559_CRIGR/896-1079:0.03182):0.04819,RPB1_HUMAN/896-1079:0.02545):0.15586,Q9U5F6_EPTBU/395-578:0.19020):0.06713,Q9PTX4_LAMRE/395-578:0.11140):0.15109):0.04562):0.09529,((O01370_9BILA/101-284:0.14652,O01375_9BILA/101-284:0.24617):0.10437,(((O01376_9BILA/101-284:0.18139,RPB1_CAEEL/886-1069:0.15763):0.16172,O01364_9BILA/101-284:0.15574):0.05678,P90678_9BILA/101-284:0.18807):0.05956):0.16019):0.07450,Q9BMP3_MONBE/814-997:0.48580):0.09011,((Q99368_SOYBN/83-267:0.16193,RPB1_ARATH/893-1077:0.18113):0.30007,((Q27095_TRIVA/891-1076:0.53185,Q9HGZ5_ASPOR/893-1076:0.49296):0.10252,((RPB1_DICDI/57-250:0.47012,RPB1_SCHPO/879-1059:0.31539):0.06720,RPB1_YEAST/873-1056:0.41291):0.15172):0.11173):0.07428):0.08266,(O77165_9EUKA/801-995:0.71098,O00820_ACACA/802-986:0.34358):0.09747):0.36962,(((Q9BJ59_LEPSE/851-1052:0.15301,Q9NJG6_LEIEN/46-247:0.05936):0.01627,(((O15680_LEITR/43-244:0.00469,(Q25268_LEIDO/43-244:0.00163,Q9NJR9_LEIDO/852-1054:0.02805):0.00924):0.00980,(Q25311_LEIME/43-244:0.00172,Q25223_LEIAM/43-244:0.00518):0.02463):0.00468,((O18713_9TRYP/43-244:0.00173,((O15679_LEITA/43-244:0.00863,O77439_9TRYP/43-244:0.00690):0.00518,O18710_9TRYP/43-244:0.00343):0.00174):0.04603,(Q25382_9TRYP/43-244:0.00775,O15678_LEIBR/43-244:0.00607):0.03625):0.00408):0.01581):0.01615,((Q25290_9TRYP/43-244:0.03178,O18712_9TRYP/43-244:0.02551):0.07422,(Q25291_9TRYP/43-244:0.00621,O18711_9TRYP/43-244:0.01119):0.05709):0.01806):0.13366):0.29662,Q26791_9TRYP/875-1076:0.00000):0.00000,Q26794_9TRYP/875-1076:0.00000):0.00000,RPB1_TRYBB/876-1077:0.00000,RPB2_TRYBB/876-1077:0.00174);
DTP  ((((((((((((((O02450_LIMPO/426-609,Q9BNE0_HADAR/35-218),O02452_MASGI/535-718),Q9NJN3_ARMVU/53-236),(Q9BNK9_9MYRI/35-218,Q9BNL1_9MYRI/35-218)),Q9BNP6_9MYRI/35-218),((Q25203_9CAEN/810-993,(((Q9XZU9_DROSU/888-1071,(Q9XZS1_DROGU/888-1071,Q9XZS2_DROMD/888-1071)),Q9XZU8_DROPS/810-993),RPB1_DROME/888-1071)),(((((RPB1_MOUSE/896-1079,O08847_MOUSE/896-1079),O35559_CRIGR/896-1079),RPB1_HUMAN/896-1079),Q9U5F6_EPTBU/395-578),Q9PTX4_LAMRE/395-578))),((O01370_9BILA/101-284,O01375_9BILA/101-284),(((O01376_9BILA/101-284,RPB1_CAEEL/886-1069),O01364_9BILA/101-284),P90678_9BILA/101-284))),Q9BMP3_MONBE/814-997),((Q99368_SOYBN/83-267,RPB1_ARATH/893-1077),((Q27095_TRIVA/891-1076,Q9HGZ5_ASPOR/893-1076),((RPB1_DICDI/57-250,RPB1_SCHPO/879-1059),RPB1_YEAST/873-1056)))),(O77165_9EUKA/801-995,O00820_ACACA/802-986)),(((Q9BJ59_LEPSE/851-1052,Q9NJG6_LEIEN/46-247),(((O15680_LEITR/43-244,(Q25268_LEIDO/43-244,Q9NJR9_LEIDO/852-1054)),(Q25311_LEIME/43-244,Q25223_LEIAM/43-244)),((O18713_9TRYP/43-244,((O15679_LEITA/43-244,O77439_9TRYP/43-244),O18710_9TRYP/43-244)),(Q25382_9TRYP/43-244,O15678_LEIBR/43-244)))),((Q25290_9TRYP/43-244,O18712_9TRYP/43-244),(Q25291_9TRYP/43-244,O18711_9TRYP/43-244)))),Q26791_9TRYP/875-1076),Q26794_9TRYP/875-1076),RPB1_TRYBB/876-1077,RPB2_TRYBB/876-1077);
DTL  11.7777
RID  0.466464
RPH  (((((((((((((((Q9BNP6_9MYRI/35-218:0.13028,((Q9PTX4_LAMRE/395-578:0.18395,Q9U5F6_EPTBU/395-578:0.11818):0.05257,((RPB1_MOUSE/896-1079:0.00000,(O08847_MOUSE/896-1079:0.00000,O35559_CRIGR/896-1079:0.00550):0.00000):0.00000,RPB1_HUMAN/896-1079:0.00000):0.14996):0.17007):0.04088,(Q9BNK9_9MYRI/35-218:0.10347,Q9BNL1_9MYRI/35-218:0.02366):0.10861):0.03143,((Q9BNE0_HADAR/35-218:0.07799,O02450_LIMPO/426-609:0.10885):0.00973,O02452_MASGI/535-718:0.06908):0.09473):0.07857,(Q9NJN3_ARMVU/53-236:0.24192,((((Q9XZU9_DROSU/888-1071:0.00000,Q9XZS1_DROGU/888-1071:0.00000):0.00000,Q9XZS2_DROMD/888-1071:0.01092):0.03050,Q9XZU8_DROPS/810-993:0.00937):0.03116,RPB1_DROME/888-1071:0.05015):0.18416):0.11118):0.07089,Q25203_9CAEN/810-993:0.34804):0.08293,((((O01370_9BILA/101-284:0.13481,O01375_9BILA/101-284:0.17921):0.09531,P90678_9BILA/101-284:0.15005):0.04934,O01364_9BILA/101-284:0.10933):0.03094,(O01376_9BILA/101-284:0.10383,RPB1_CAEEL/886-1069:0.08716):0.13745):0.16816):0.18203,Q9BMP3_MONBE/814-997:0.56549):0.23145,((O00820_ACACA/802-986:0.49098,RPB1_DICDI/57-250:0.51370):0.15472,(Q99368_SOYBN/83-267:0.16800,RPB1_ARATH/893-1077:0.16724):0.38663):0.08653):0.12507,((Q9HGZ5_ASPOR/893-1076:0.60148,RPB1_YEAST/873-1056:0.43871):0.13828,RPB1_SCHPO/879-1059:0.42133):0.05302):0.17961,Q27095_TRIVA/891-1076:0.72235):0.06952,O77165_9EUKA/801-995:1.00876):0.74289,(((O15680_LEITR/43-244:0.00000,Q25268_LEIDO/43-244:0.00000):0.00000,Q9NJR9_LEIDO/852-1054:0.03112):0.00000,((O15679_LEITA/43-244:0.00503,(O77439_9TRYP/43-244:0.00000,(O18713_9TRYP/43-244:0.00000,O18710_9TRYP/43-244:0.00000):0.00000):0.00505):0.01520,(Q25223_LEIAM/43-244:0.00000,(((((Q25290_9TRYP/43-244:0.00000,O18712_9TRYP/43-244:0.01020):0.04127,(Q25291_9TRYP/43-244:0.00506,O18711_9TRYP/43-244:0.01016):0.01010):0.01026,(Q25382_9TRYP/43-244:0.00000,O15678_LEIBR/43-244:0.00510):0.02047):0.00508,(Q9NJG6_LEIEN/46-247:0.06337,Q9BJ59_LEPSE/851-1052:0.12147):0.00996):0.00000,Q25311_LEIME/43-244:0.00504):0.00000):0.00000):0.00504):0.15352):0.22250,Q26794_9TRYP/875-1076:0.00000):0.00000,Q26791_9TRYP/875-1076:0.00000):0.00000,RPB1_TRYBB/876-1077:0.00000,RPB2_TRYBB/876-1077:0.00000);
RTP  (((((((((((((((Q9BNP6_9MYRI/35-218,((Q9PTX4_LAMRE/395-578,Q9U5F6_EPTBU/395-578),((RPB1_MOUSE/896-1079,(O08847_MOUSE/896-1079,O35559_CRIGR/896-1079)),RPB1_HUMAN/896-1079))),(Q9BNK9_9MYRI/35-218,Q9BNL1_9MYRI/35-218)),((Q9BNE0_HADAR/35-218,O02450_LIMPO/426-609),O02452_MASGI/535-718)),(Q9NJN3_ARMVU/53-236,((((Q9XZU9_DROSU/888-1071,Q9XZS1_DROGU/888-1071),Q9XZS2_DROMD/888-1071),Q9XZU8_DROPS/810-993),RPB1_DROME/888-1071))),Q25203_9CAEN/810-993),((((O01370_9BILA/101-284,O01375_9BILA/101-284),P90678_9BILA/101-284),O01364_9BILA/101-284),(O01376_9BILA/101-284,RPB1_CAEEL/886-1069))),Q9BMP3_MONBE/814-997),((O00820_ACACA/802-986,RPB1_DICDI/57-250),(Q99368_SOYBN/83-267,RPB1_ARATH/893-1077))),((Q9HGZ5_ASPOR/893-1076,RPB1_YEAST/873-1056),RPB1_SCHPO/879-1059)),Q27095_TRIVA/891-1076),O77165_9EUKA/801-995),(((O15680_LEITR/43-244,Q25268_LEIDO/43-244),Q9NJR9_LEIDO/852-1054),((O15679_LEITA/43-244,(O77439_9TRYP/43-244,(O18713_9TRYP/43-244,O18710_9TRYP/43-244))),(Q25223_LEIAM/43-244,(((((Q25290_9TRYP/43-244,O18712_9TRYP/43-244),(Q25291_9TRYP/43-244,O18711_9TRYP/43-244)),(Q25382_9TRYP/43-244,O15678_LEIBR/43-244)),(Q9NJG6_LEIEN/46-247,Q9BJ59_LEPSE/851-1052)),Q25311_LEIME/43-244))))),Q26794_9TRYP/875-1076),Q26791_9TRYP/875-1076),RPB1_TRYBB/876-1077,RPB2_TRYBB/876-1077);
RTL  12.2108
LNK  O00820_ACACA/802-986:O00820:U90211
LNK  O01364_9BILA/101-284:O01364:U73451
LNK  O01370_9BILA/101-284:O01370:U73454
LNK  O01375_9BILA/101-284:O01375:U73456
LNK  O01376_9BILA/101-284:O01376:U73448
LNK  O02416_APHCH/53-236:O02416:
LNK  O02428_DYSCR/53-236:O02428:
LNK  O02450_LIMPO/426-609:O02450:U90037
LNK  O02452_MASGI/535-718:O02452:U90038
LNK  O08847_MOUSE/896-1079:O08847:U37500
LNK  O15678_LEIBR/43-244:O15678:AF009155
LNK  O15679_LEITA/43-244:O15679:AF009166
LNK  O15680_LEITR/43-244:O15680:AF009167
LNK  O18710_9TRYP/43-244:O18710:AF009153
LNK  O18711_9TRYP/43-244:O18711:AF009156
LNK  O18712_9TRYP/43-244:O18712:AF009158
LNK  O18713_9TRYP/43-244:O18713:AF009162
LNK  O35559_CRIGR/896-1079:O35559:D87293
LNK  O77165_9EUKA/801-995:O77165:AF083338
LNK  O77439_9TRYP/43-244:O77439:AF009159
LNK  P90678_9BILA/101-284:P90678:U61762
LNK  P91819_ZELPU/98-281:P91819:
LNK  Q17085_ARTSA/808-991:Q17085:
LNK  Q23699_CRAGI/807-990:Q23699:
LNK  Q25151_9ANNE/803-986:Q25151:
LNK  Q25203_9CAEN/810-993:Q25203:U10338
LNK  Q25223_LEIAM/43-244:Q25223:AF009154
LNK  Q25268_LEIDO/43-244:Q25268:AF009157
LNK  Q25290_9TRYP/43-244:Q25290:AF009160
LNK  Q25291_9TRYP/43-244:Q25291:AF009161
LNK  Q25311_LEIME/43-244:Q25311:AF009164
LNK  Q25312_LEIMA/853-1054:Q25312:
LNK  Q25382_9TRYP/43-244:Q25382:AF009165
LNK  Q26791_9TRYP/875-1076:Q26791:J03157
LNK  Q26794_9TRYP/875-1076:Q26794:J04841
LNK  Q27095_TRIVA/891-1076:Q27095:U20501
LNK  Q99368_SOYBN/83-267:Q99368:X52495
LNK  Q9BJ59_LEPSE/851-1052:Q9BJ59:AF338253
LNK  Q9BMP3_MONBE/814-997:Q9BMP3:AF315821
LNK  Q9BNE0_HADAR/35-218:Q9BNE0:AF241005
LNK  Q9BNE5_9ARAC/45-228:Q9BNE5:
LNK  Q9BNJ6_9MYRI/51-234:Q9BNJ6:
LNK  Q9BNK9_9MYRI/35-218:Q9BNK9:AF240936
LNK  Q9BNL1_9MYRI/35-218:Q9BNL1:AF240934
LNK  Q9BNN0_9MYRI/35-218:Q9BNN0:
LNK  Q9BNN8_9MYRI/35-218:Q9BNN8:
LNK  Q9BNP6_9MYRI/35-218:Q9BNP6:AF240899
LNK  Q9GNX2_9TRYP/31-232:Q9GNX2:
LNK  Q9GNZ5_LEIMA/30-230:Q9GNZ5:
LNK  Q9GP01_LEIGU/33-232:Q9GP01:
LNK  Q9GP03_9TRYP/31-232:Q9GP03:
LNK  Q9HGZ5_ASPOR/893-1076:Q9HGZ5:AB017184
LNK  Q9NJG6_LEIEN/46-247:Q9NJG6:AF151727
LNK  Q9NJJ2_9HEXA/356-539:Q9NJJ2:
LNK  Q9NJJ7_9MYRI/547-730:Q9NJJ7:
LNK  Q9NJK2_9MYRI/547-730:Q9NJK2:
LNK  Q9NJN3_ARMVU/53-236:Q9NJN3:AF138970
LNK  Q9NJR9_LEIDO/852-1054:Q9NJR9:AF126254
LNK  Q9PTX4_LAMRE/395-578:Q9PTX4:AB025332
LNK  Q9U5F6_EPTBU/395-578:Q9U5F6:AB025331
LNK  Q9XZS1_DROGU/888-1071:Q9XZS1:Y18878
LNK  Q9XZS2_DROMD/888-1071:Q9XZS2:Y18877
LNK  Q9XZU8_DROPS/810-993:Q9XZU8:Y18879
LNK  Q9XZU9_DROSU/888-1071:Q9XZU9:Y18876
LNK  RPB1_ARATH/893-1077:P18616:X52494
LNK  RPB1_CAEEL/886-1069:P16356:U53333
LNK  RPB1_DICDI/57-250:P35084:S52651
LNK  RPB1_DROME/888-1071:P04052:M27431
LNK  RPB1_HUMAN/896-1079:P24928:X63564
LNK  RPB1_MOUSE/896-1079:P08775:M12130
LNK  RPB1_SCHPO/879-1059:P36594:X56564
LNK  RPB1_TRYBB/876-1077:P17545:X13492
LNK  RPB1_YEAST/873-1056:P04050:X03128
LNK  RPB2_TRYBB/876-1077:P17546:X13491
AMK  xxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxx.xxxx...x.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxx.........xxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  RPB1_YEAST/873-1056
ASQ  MDAAHIE.KQSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLE-----SGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVD--.GEANWPLPVNIRRIIQNAQQTFHID.HTKPSDL.TIKDIVLGVKDLQENLLVLRGK--.--NE...-.IIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQAFDWVLSNIEAQFLRS
DSQ  ATGGATGCTGCGCATATTGAA...AAGCAATCGCTAGATACTATTGGTGGCTCCGATGCAGCTTTTGAAAAGAGATACAGAGTTGATTTATTGAATACAGACCATACCCTTGATCCCTCACTATTGGAA---------------TCCGGATCTGAGATACTTGGCGATTTGAAACTTCAAGTTCTCCTGGATGAAGAATACAAACAATTAGTGAAAGATCGTAAATTTTTGAGGGAAGTTTTTGTTGAT------...GGTGAAGCAAACTGGCCATTACCAGTCAACATAAGACGTATTATTCAAAATGCTCAACAAACTTTCCACATAGAT...CATACGAAACCATCTGATTTA...ACAATCAAAGACATCGTTCTTGGTGTAAAGGATTTGCAAGAAAACTTATTAGTGTTGCGTGGTAAG------...------AATGAA.........---...ATTATACAAAATGCCCAGCGAGATGCAGTTACATTGTTCTGCTGTTTATTACGTTCCCGTTTGGCCACACGTAGAGTTCTGCAAGAGTACAGACTAACAAAACAGGCATTCGATTGGGTATTAAGTAATATCGAGGCACAATTCCTCCGTTCT
TRN  10010101100011000
NAM  RPB1_SCHPO/879-1059
ASQ  LDATLVE.YQVFDSLRLSTKQFEKKYRIDLME-DRSLSLYMEN-----SIE---NDSSVQDLLDEEYTQLVADRELLCKFIFPK-.GDARWPLPVNVQRIIQNALQIFHLE.AKKPTDL.LPSDIINGLNELIAKLTIFRGS--.--DR...-.ITRDVQNNATLLFQILLRSKFAVKRVIMEYRLNKVAFEWIMGEVEARFQQA
DSQ  CTGGATGCCACATTAGTAGAG...TACCAGGTTTTTGACTCATTAAGGTTATCCACTAAGCAATTTGAAAAGAAGTATCGAATTGATTTAATGGAG---GATAGGAGTTTATCATTGTATATGGAGAAC---------------TCTATTGAG---------AACGATTCTTCAGTACAAGACTTATTAGATGAGGAGTATACACAGCTGGTTGCTGATCGTGAGTTACTATGCAAATTTATTTTCCCCAAA---...GGTGATGCTAGATGGCCTTTACCTGTCAATGTACAAAGAATCATCCAAAATGCTTTACAAATATTCCATTTAGAA...GCTAAAAAACCCACCGATCTT...TTACCGAGTGATATTATTAACGGGTTAAATGAACTAATTGCAAAATTAACAATTTTCCGCGGAAGT------...------GACCGT.........---...ATTACTCGTGATGTTCAAAACAACGCTACCTTGTTATTCCAGATTTTATTAAGGTCCAAATTTGCTGTAAAACGGGTAATAATGGAATACCGACTTAACAAAGTCGCATTTGAATGGATTATGGGTGAAGTGGAAGCTCGTTTCCAACAAGCT
TRN  10010101100011000
NAM  Q9HGZ5_ASPOR/893-1076
ASQ  LDGAHIE.NQRVDIIKCSDDQFRDRFRIDLMDPERSLGPEVLE-----QANEIAGDVEVQRYLDEEWEQLLKARAFLRTVAKE--.DEEMMQLPINVQRILEMARTTFRIR.EGTISDL.HPAEVIPQVQALLDRLLIVRGD--.--DP...-.ISQEAQENATLLFKAQLRSRLAFRRLVTEYSMNKLAFQHVIGAIESRFAKA
DSQ  CTTGACGGTGCTCATATTGAG...AACCAACGAGTCGACATCATTAAATGCTCTGACGACCAGTTTAGAGATCGTTTCCGTATCGATCTTATGGACCCTGAGCGCAGCTTAGGTCCAGAGGTCTTAGAA---------------CAGGCCAATGAAATTGCAGGCGACGTCGAAGTCCAGAGATATCTGGATGAAGAATGGGAGCAACTTCTCAAAGCCCGTGCTTTCCTCCGTACTGTGGCTAAGGAA------...GACGAGGAGATGATGCAGCTTCCAATCAACGTCCAGCGAATTCTCGAGATGGCTAGAACTACGTTTAGAATCCGC...GAGGGAACCATTAGCGATTTA...CACCCAGCCGAAGTTATCCCTCAGGTACAAGCATTGCTTGATCGGCTGCTTATCGTGCGCGGTGAT------...------GACCCG.........---...ATCTCGCAGGAAGCCCAGGAGAATGCCACACTGTTGTTCAAGGCCCAACTTCGGAGTCGTCTGGCGTTCCGAAGACTGGTCACCGAGTATTCCATGAATAAACTTGCGTTCCAGCATGTTATTGGAGCCATCGAAAGTAGGTTCGCTAAAGCT
TRN  10010101100011010
NAM  RPB1_DROME/888-1071
ASQ  LCGELVE.FQNMPTVKLSNKSFEKRFKFDWSN-ERLMKKVFTD----DVIKEMTDSSEAIQELEAEWDRLVSDRDSLRQIFPN--.GESKVVLPCNLQRMIWNVQKIFHIN.KRLPTDL.SPIRVIKGVKTLLERCVIVTGN--.--DR...-.ISKQANENATLLFQCLIRSTLCTKYVSEEFRLSTEAFEWLVGEIETRFQQA
DSQ  CTTTGCGGCGAGCTGGTTGAG...TTCCAGAACATGCCAACGGTGAAACTGTCGAACAAGTCGTTTGAAAAGCGCTTCAAATTTGACTGGAGCAAC---GAGCGATTAATGAAAAAGGTATTTACGGAT------------GATGTGATCAAGGAGATGACCGACAGCAGCGAAGCCATCCAGGAACTGGAGGCAGAGTGGGATCGTTTGGTTTCCGATCGCGACAGTTTGAGACAAATCTTCCCTAAC------...GGCGAATCCAAGGTGGTACTGCCGTGCAACCTGCAGCGTATGATCTGGAATGTGCAGAAGATCTTTCACATCAAC...AAGCGCCTGCCCACGGATCTC...TCGCCCATTCGGGTGATCAAGGGCGTTAAGACATTGCTCGAACGCTGTGTTATTGTCACGGGAAAT------...------GATCGA.........---...ATTTCAAAGCAGGCCAACGAGAACGCCACGTTGCTATTCCAGTGCCTAATCCGTTCGACACTATGTACGAAATACGTGTCGGAGGAGTTCCGCCTGTCCACAGAGGCGTTTGAGTGGTTGGTCGGAGAAATCGAGACGCGTTTCCAACAGGCC
TRN  10010101100011000
NAM  Q9XZU8_DROPS/810-993
ASQ  LCGELVD.FQNMPTVKLSNKAFEKRFKFDWSN-ERYMRKVFTD----EVIKEMTDSSEAIQDLESEWDHLMQDRDHLRQIFPN--.GDSKVVLPCNLQRMIWNVQKIFHIN.KRLPTDL.SPMRVIKGVKTLLERCVIVTGA--.--DR...-.ISKQANENATLLFQCLIRSTLCTKYVSEEFRLSTEAFEWLIGEIETRFQQA
DSQ  CTCTGCGGCGAGCTGGTCGAC...TTCCAGAACATGCCGACGGTGAAACTCTCCAACAAGGCGTTCGAGAAGCGCTTCAAGTTCGACTGGTCGAAC---GAGCGATACATGCGCAAGGTCTTCACGGAC------------GAGGTGATCAAGGAGATGACCGACAGCAGCGAGGCCATACAGGATCTCGAATCGGAGTGGGACCACCTGATGCAGGATCGCGACCATTTGCGACAGATCTTCCCCAAC------...GGCGATTCGAAGGTGGTGCTGCCCTGCAATCTGCAGCGCATGATCTGGAATGTACAGAAGATATTCCACATTAAC...AAGCGCCTGCCCACAGACCTC...TCGCCCATGCGGGTGATCAAAGGCGTGAAGACCCTGCTGGAGCGTTGTGTAATCGTGACTGGCGCC------...------GACCGG.........---...ATATCAAAGCAGGCCAACGAGAATGCCACGTTGCTGTTCCAGTGCCTAATCCGGTCCACGCTGTGCACCAAATACGTGTCCGAGGAGTTTCGCCTCTCCACAGAGGCCTTTGAGTGGCTGATCGGTGAGATCGAGACGCGGTTCCAGCAGGCC
TRN  10010101100011001
NAM  Q9XZS2_DROMD/888-1071
ASQ  LCGELVE.FQNMPTVKLSNKAFEKRFKFDWSN-ERYMRKVFTD----EVIKEITDSSEAIQDLESEWDNLMHDRDNLR-VIFPN-.GDSKVVLPCNLQRMIWNVQKIFHIN.KRLPTDL.SPMRVIKGVKTLLERCVIVTGA--.--DR...-.ISKQANENATLLFQCLIRSTLCTKYVSEEFRLSTEAFEWLIGEIETRFQQA
DSQ  CTCTGCGGCGAGCTGGTTGAG...TTCCAGAACATGCCCACCGTGAAGCTCTCGAACAAGGCGTTCGAGAAGCGCTTCAAGTTCGATTGGTCGAAC---GAGCGATACATGCGCAAGGTCTTCACCGAT------------GAGGTGATCAAAGAGATTACCGATAGCAGCGAGGCCATACAGGATCTCGAATCGGAGTGGGATAATCTGATGCACGATCGCGATAACTTGCGA---GTTATCTTTCCCAAT---...GGCGATTCGAAGGTGGTGCTGCCGTGCAATCTGCAGCGCATGATCTGGAACGTGCAGAAGATATTCCACATTAAC...AAGCGACTGCCCACAGACCTC...TCGCCCATGCGGGTGATCAAGGGCGTGAAGACACTGCTGGAGCGTTGCGTGATTGTGACGGGCGCT------...------GATCGC.........---...ATATCGAAGCAGGCCAACGAGAATGCCACATTGCTGTTCCAGTGCCTCATTCGGTCGACGCTGTGCACGAAATATGTGTCCGAGGAGTTTCGCCTGTCGACGGAGGCCTTTGAGTGGCTGATCGGTGAGATTGAGACACGCTTCCAGCAGGCC
TRN  10010101100011011
NAM  Q9XZS1_DROGU/888-1071
ASQ  LCGELVE.FQNMPTVKLSNKAFEKRFKFDWSN-ERYMRKVFTD----EVIKEMTDSSEAIQDLESEWDHLMHDRDNLR-VIFPN-.GDSKVVLPCNLQRMIWNVQKIFHIN.KRLPTDL.SPMRVIKGVKTLLERCVIVTGA--.--DR...-.ISKQANENATLLFQCLIRSTLCTKYVSEEFRLSTEAFEWLIGEIETRFQQA
DSQ  CTCTGCGGCGAGCTGGTTGAG...TTCCAGAACATGCCCACCGTGAAGCTCTCGAACAAGGCGTTCGAGAAGCGCTTCAAGTTCGATTGGTCGAAC---GAGCGCTACATGCGCAAGGTCTTCACCGAT------------GAGGTGATCAAAGAGATGACCGATAGCAGCGAGGCCATACAGGATCTCGAATCGGAGTGGGATCATCTGATGCACGATCGCGATAACTTGCGA---GTTATCTTCCCCAAT---...GGTGATTCGAAGGTGGTGCTGCCGTGCAATCTGCAGCGCATGATTTGGAACGTACAGAAGATATTCCACATTAAC...AAGCGACTGCCCACAGACCTC...TCGCCCATGCGGGTGATCAAGGGCGTGAAGACACTGCTGGAGCGTTGCGTGATTGTGACGGGCGCT------...------GATCGC.........---...ATATCGAAGCAGGCCAACGAGAATGCCACATTGCTGTTTCAGTGCCTCATTCGGTCGACGCTGTGTACGAAATATGTGTCCGAGGAGTTTCGCCTGTCGACGGAGGCCTTTGAGTGGCTGATCGGTGAGATTGAGACACGCTTCCAGCAGGCC
TRN  10010101100011011
NAM  Q9XZU9_DROSU/888-1071
ASQ  LCGELVE.FQNMPTVKLSNKAFEKRFKFDWSN-ERYMRKVFTD----EVIKEMTDSSEAIQDLESEWDHLMHDRDNLR-VIFPN-.GDSKVVLPCNLQRMIWNVQKIFHIN.KRLPTDL.SPMRVIKGVKTLLERCVIVTGA--.--DR...-.ISKQANENATLLFQCLIRSTLCTKYVSEEFRLSTEAFEWLIGEIETRFQQA
DSQ  CTCTGCGGCGAGCTGGTTGAG...TTCCAGAACATGCCCACCGTGAAGCTCTCGAACAAGGCGTTCGAGAAGCGCTTCAAGTTCGATTGGTCGAAC---GAGCGATACATGCGGAAGGTCTTCACCGAC------------GAGGTGATCAAAGAGATGACCGATAGCAGCGAGGCCATACAGGATCTCGAATCGGAGTGGGATCATCTGATGCACGATCGCGATAACTTGCGA---GTTATCTTCCCCAAT---...GGCGACTCGAAGGTGGTGCTGCCGTGCAATCTGCAGCGCATGATCTGGAACGTGCAGAAGATATTCCACATTAAC...AAGCGACTGCCCACAGACCTC...TCGCCCATGCGGGTGATCAAGGGCGTGAAGACACTGCTGGAGCGTTGCGTGATTGTGACGGGCGCT------...------GATCGC.........---...ATATCGAAGCAGGCCAACGAGAATGCCACATTGCTGTTCCAGTGCCTCATTCGGTCGACGCTGTGCACGAAATATGTGTCCGAGGAGTTTCGCCTGTCGACGGAGGCCTTTGAGTGGCTGATCGGTGAGATTGAGACACGCTTCCAGCAGGCC
TRN  10010101100011011
NAM  Q17085_ARTSA/808-991
ASQ  LAGELVE.FQSLPTIKLSNRAFESKYRFDPSN-ERQLRKTFTE----DVTKSLLGDSEVITEIEKEWEALVKDREALRKVFPS--.GENKVVLPCNLQRMIWNAQKTFHIN.KRMPSDL.SPLRVIQGVRDLLKNCVIVNGE--.--DK...-.LSKQANENATLLFQCLVRSTLCTKRLADEYRLNTEAFEWLIGEIETRFQLA
NAM  Q9NJJ2_9HEXA/356-539
ASQ  LDGVQVE.FQSLPTVKLSNRSFESKFKFDPTN-ERYLRRVFTE----DVMRDIMGSGEVISAIEKEWEALQKDRAVLRQIFPT--.GENKVVLPCNLQRMIWNVQKIFHIN.KRAPTDL.NPVRVIEGVEDLLKKCVIVVGE--.--DR...-.LSKQANANATLLFQCLVRSTLCTKRVAEEFRLSSEAFEWLIGEVETRFQQA
NAM  Q9NJN3_ARMVU/53-236
ASQ  LAGEYVE.FQKMPTVKLSYRRFEDKYRFDVTN-ERYLRHLFNE----DVVRELLGSPEAINILEVEWQKLQEDRVALRQVFPK--.GDTKVVLPCNLERMIWNVQKIFHIN.KRMQTDL.SPIKVVEGVNETLRKCMIVSGE--.--DR...-.ISVQANENATLLFHCLVRSTLCTKKVSEEYRLTTEAFNWLMGEIETRFNQA
DSQ  TTGGCCGGAGAATATGTAGAG...TTCCAGAAAATGCCAACTGTCAAATTATCTTACAGAAGATTTGAAGATAAATACAGATTTGATGTAACCAAT---GAAAGATATCTAAGGCATTTATTTAATGAA------------GACGTTGTGAGAGAGCTTCTTGGCTCACCAGAAGCCATTAATATTTTAGAAGTAGAATGGCAGAAACTTCAAGAAGATAGAGTAGCTCTTCGACAGGTTTTTCCAAAG------...GGAGACACTAAGGTTGTGTTGCCTTGCAATCTTGAACGTATGATTTGGAATGTTCAAAAAATTTTTCATATCAAT...AAAAGAATGCAGACAGATTTA...TCTCCTATAAAAGTTGTTGAAGGAGTTAATGAAACATTAAGGAAATGTATGATCGTGTCAGGGGAA------...------GATCGA.........---...ATCAGTGTTCAAGCAAATGAAAATGCTACTCTTCTCTTTCATTGCTTAGTTCGATCCACTCTGTGTACTAAAAAAGTGTCTGAAGAATATAGGCTTACAACAGAAGCATTTAACTGGCTTATGGGTGAAATTGAAACCAGATTTAACCAAGCT
TRN  10010101100011000
NAM  Q9BNP6_9MYRI/35-218
ASQ  LDGGAVE.FQALPTLKPSNKTFEKKFKFDISN-ERQLKKIFNE----DIVKELMGSAHIVGELEKEWEHLKTDREILRSVFPK--.GDSKVVLPCNLPRMIWNAQKIFHIN.TRSPTDL.NPFRVIDGVRELGKKIIIVPGE--.--DP...-.LSCQANKNATLLFNCLLRSTLCTRRVAEEFRLSSEAFEWLLGEIETRFQQS
DSQ  CTCGACGGTGGTGCCGTCGAG...TTCCAAGCCTTGCCGACGCTGAAACCGTCCAACAAGACGTTCGAGAAGAAGTTCAAGTTTGACATCTCGAAC---GAACGGCAACTGAAAAAGATCTTTAATGAA------------GACATTGTCAAAGAATTGATGGGAAGCGCCCATATCGTTGGAGAACTGGAAAAGGAATGGGAACATCTCAAGACCGATCGTGAAATCTTGAGATCGGTTTTCCCTAAA------...GGCGATAGCAAAGTGGTTTTGCCTTGCAACTTGCCCCGGATGATCTGGAACGCGCAGAAAATTTTCCACATCAAC...ACTCGTTCTCCGACCGATTTA...AACCCATTCCGGGTCATTGACGGTGTTCGAGAACTCGGCAAAAAGATCATCATCGTGCCCGGCGAA------...------GACCCC.........---...CTCAGTTGCCAGGCCAACAAGAACGCAACGCTTCTGTTCAATTGCCTCCTCCGTTCAACTTTGTGCACGAGACGGGTGGCGGAAGAATTCCGACTGTCCAGCGAAGCCTTTGAGTGGCTGCTGGGAGAAATCGAGACGCGTTTCCAACAATCG
TRN  10010101100011000
NAM  Q9NJJ7_9MYRI/547-730
ASQ  LDGGAVE.FQTLPTLKPSNKAFEKKFKFDISN-ERQLKKIFNE----DIVKELMGSANIVGELEKEWETLKRDRETLRQVFPK--.GDSKVVLPCNLPRMIWNAQKIFHIN.TRVPTDL.NPFRVIEGVRELVKKIVIVQGE--.--DP...-.LSRMANENATLLFDCLLRSTLCTKRVAEEFRLSSEAFEWLLGEIETRFQQA
NAM  Q9BNN0_9MYRI/35-218
ASQ  LDGGAVE.FQTLPTLKPSNKAFEKKFKFDISN-ERQLKRVFNE----DIVKELNGSAHIVSQLDKEWEFLKKDRETLRSVFPK--.GDSKVVLPCNLPRMIWNAQKIFHIN.TRTPTDL.NPLRVLEGVRELSSKLIIVPGE--.--DY...-.LSCQANENATLLFNCLLRSTLCTKRVAEEFRLSTEAFDWLLGEIETRFQQS
NAM  Q9BNJ6_9MYRI/51-234
ASQ  LDGGAVE.FQALPTLKPSNKAFEKKFKFDVSN-ERQLKRVFNE----DIVKDLMGSSHIVTQLEKEWETLKKDREVLRSVFPK--.GDSKVVLPCNLPRMIWNAQKIFHIN.TRTPTDL.TPLRVLDGVRELSSKIIIVPGE--.--DY...-.LSCQANENATLLFNCLLRSTLCTKRVAEEFRLSTEAFEWLLGEIETRFQHS
NAM  Q9BNN8_9MYRI/35-218
ASQ  LDGCAVE.GQALPTLKPSDKTFEKRFKFDVSN-ERQLKRVFNE----DIVKDLLGSANVVGDLELEWESLCKDREVLRTVFPK--.GDSKVVLPCNLQRMIWNAQKIFHIN.IRSPTDL.NPSRVIEGVRELSKKIIIVVGE--.--DR...-.LSKQANENATLLFNCLLRSTLCTKRVAEEFRLSAESFEWLLGEIETRFQQS
NAM  Q9NJK2_9MYRI/547-730
ASQ  LDGGAVE.FQALPTLKPSNKAFEKKFRFDASN-ERQLRRVFNE----EIVKDLFGSASAVGELEREWXTLKLDREVLRTIFPK--.GDSKVVLPCNLQRMIWNAQKIFHIN.VRTPTDL.SPLRVIEGVRDLTKKLVIVVGE--.--DA...-.LSKQANDNATLLINCLIRSTLCTKRVAEEFRLSAEAFEWLLGEIETRFQHA
NAM  Q9BNL1_9MYRI/35-218
ASQ  LDGGAVE.FQTLPTLKPSNKAFEKKFRFDVTN-ERQLRRVFNE----DIVKELIGSAHAVAELEKEWETLKRDRELLRH-IFPK-.GDNKVVLPGNLQRMIWNAQKIFHIN.LRAPTDL.SPLKVIDGVRELSKRLVIVPGE--.--DS...-.LSKQANENATLLFNCLLQSTLCTKRVAEEFRLSTEAFEWLLGEIETRFNQA
DSQ  CTAGATGGTGGTGCTGTCGAA...TTTCAGACGTTGCCTACTTTAAAACCTTCAAATAAAGCGTTCGAGAAGAAATTCAGGTTTGATGTGACCAAC---GAACGTCAGCTGCGGCGTGTTTTCAATGAG------------GACATTGTCAAAGAACTGATAGGCAGTGCACATGCTGTAGCAGAATTGGAGAAGGAGTGGGAGACGCTGAAAAGAGACAGAGAATTGCTGAGACAC---ATATTTCCGAAA---...GGAGATAATAAGGTTGTGTTGCCAGGTAATCTTCAGCGTATGATTTGGAATGCTCAGAAGATTTTTCATATCAAT...TTGCGTGCCCCGACCGATCTT...AGCCCACTCAAAGTGATTGATGGAGTTAGAGAGTTGAGTAAAAGACTTGTAATTGTGCCTGGAGAG------...------GATAGT.........---...TTAAGCAAGCAGGCCAATGAAAACGCAACATTACTATTCAACTGTCTTCTGCAATCAACATTGTGCACAAAACGTGTTGCAGAAGAGTTCAGGCTGTCCACAGAGGCGTTTGAGTGGTTGTTGGGTGAAATTGAAACTAGGTTTAACCAGGCT
TRN  10010101100011000
NAM  Q9BNK9_9MYRI/35-218
ASQ  LDGGAVE.FQTLPTLKPSNKAFEKKFRFDVTN-ERQLRRVFNE----DVVKELIGSAHVVAELEREWEALKQERELLR-AIFPK-.GDNKVVLPGNIQRMIWNAQKIFHIN.LRAPTDL.SPLKVLEGAKELCQKIIVVPGE--.--DG...-.LSKQANENATLLFKCLIHSTLCTKRVAEEFRLSTEAFEWLLGEIETRFNQA
DSQ  CTTGATGGTGGCGCTGTTGAA...TTCCAAACATTACCTACTCTGAAGCCTTCTAATAAGGCGTTTGAGAAAAAGTTTAGATTCGACGTTACCAAC---GAACGTCAACTGAGACGCGTGTTTAATGAA------------GACGTTGTCAAAGAACTGATTGGCAGCGCCCACGTTGTGGCCGAACTAGAACGCGAGTGGGAAGCCCTGAAGCAAGAGAGGGAGTTGCTTCGA---GCCATTTTTCCTAAG---...GGAGACAATAAGGTTGTACTACCCGGCAATATTCAGCGAATGATTTGGAACGCACAAAAGATTTTTCACATTAAC...CTTCGTGCTCCAACAGACCTT...AGCCCATTAAAAGTTCTTGAAGGTGCCAAGGAACTCTGCCAGAAAATCATAGTAGTACCTGGCGAG------...------GATGGC.........---...CTTAGTAAACAAGCTAACGAAAATGCAACACTTCTTTTTAAGTGTTTGATACACTCCACTTTGTGCACCAAACGGGTGGCAGAAGAATTTCGTTTGTCTACAGAAGCGTTTGAATGGTTGTTGGGAGAAATTGAAACAAGATTTAATCAAGCG
TRN  10010101100011010
NAM  Q9BNE5_9ARAC/45-228
ASQ  LEGSTVE.SQSLPTLKPSDKAFEKRFKFDASN-ERYMHRIFTE----EVVRELMGSAMALSELEKEWERLKKDREVLRTIFPT--.GDSKVVMPCNLQRMIWNAQKIFHVN.TRSQTDL.SPLRTIKGVEDLVKKLVIVPGE--.--DR...-.LSIQANDNATLLFRALLRSTLCTKRVSDEFRLSTEAFDWLLEEIETKFQQA
NAM  Q9BNE0_HADAR/35-218
ASQ  LDGSSVE.FQSLPTLKPSNKAFERKFKFDPSN-ERYLRRIFTE----DVVRELMGSATALSELEREWERLEKDRRVLRSIFPT--.GDSKVVLPCNLQRMIWNAQKIFHVN.LRSATDL.SPLRVVQGVEELVKKLVVVPGE--.--DR...-.LSIQANENATLLFRALLRSTLCTKRVAEEFRLSSEAFEWLLGEIETRFHQA
DSQ  TTGGATGGATCATCAGTTGAA...TTTCAATCATTACCAACTCTGAAACCTTCAAATAAAGCATTTGAAAGGAAATTCAAATTTGATCCTTCAAAT---GAGAGGTATTTAAGACGGATTTTCACTGAA------------GATGTTGTCAGAGAATTGATGGGAAGTGCAACTGCTCTTAGTGAATTAGAAAGAGAATGGGAAAGATTAGAAAAAGACAGAAGAGTTTTGCGTTCTATATTCCCTACT------...GGTGATAGTAAGGTGGTACTACCATGTAATTTGCAAAGAATGATATGGAATGCACAGAAAATTTTTCATGTAAAT...CTAAGATCTGCTACTGATCTT...AGTCCATTAAGAGTTGTACAAGGTGTTGAAGAACTGGTTAAAAAATTAGTTGTGGTTCCGGGAGAA------...------GACAGA.........---...CTGAGTATTCAAGCTAATGAGAATGCAACTTTACTTTTTCGTGCCTTGCTTCGGTCAACACTTTGTACTAAACGTGTAGCAGAAGAATTCCGCTTATCATCTGAAGCATTTGAATGGCTGTTGGGTGAAATTGAAACAAGATTCCATCAAGCT
TRN  10010101100011000
NAM  O02450_LIMPO/426-609
ASQ  LDGTAVE.VQSLPTLKPSDKAFEKKFRFNASN-ERYLRRIFTE----DVVRDLMGSATALSELEKEWEKLKHDRELLRAIFPT--.GDSKVVLPCNLQRMIWSAQKIFHVN.QRAPTDL.SPLKVIGGVEELVKKLVVVPGE--.--DR...-.LSIQANDNATILFRALLRSTLCAKRVAEEFRLSSESFQWLLGEIEARFQQA
DSQ  TTAGATGGGACAGCTGTAGAA...GTTCAGTCACTACCAACACTGAAACCTTCAGATAAAGCATTTGAGAAGAAGTTTAGGTTTAATGCATCCAAT---GAAAGGTATTTACGACGTATCTTTACTGAG------------GATGTAGTGAGAGACTTGATGGGCAGTGCCACTGCACTGAGTGAACTAGAGAAAGAATGGGAAAAACTGAAACATGACAGGGAATTATTGAGGGCCATTTTCCCTACA------...GGTGATAGTAAGGTAGTTCTACCTTGTAACCTTCAGAGAATGATCTGGAGTGCACAGAAGATTTTTCATGTCAAT...CAGAGAGCCCCTACAGATTTA...AGTCCTTTGAAAGTGATTGGAGGTGTCGAAGAACTTGTGAAGAAGCTAGTGGTGGTGCCTGGTGAA------...------GATAGG.........---...CTGAGTATCCAGGCTAATGATAATGCAACAATACTTTTCCGTGCCTTGCTGAGATCAACCCTTTGTGCTAAGCGTGTTGCTGAAGAGTTCAGACTATCTAGTGAATCATTCCAATGGTTGTTGGGAGAAATCGAAGCAAGATTTCAGCAGGCC
TRN  10010101100011000
NAM  O02416_APHCH/53-236
ASQ  LDGGMVE.FQHLPTLKPSDKAFEKRFRFDAAN-ERYLRRIFTE----DVVRDLLGSSTALSEFEKEWERLKTDREVLR-IIFPT-.GNSRVVLPCNLLRMIWNAQKIFHVN.TRAPTDL.SPLRVIHGVEELVKKLVIVPGE--.--DR...-.LSIQANENATILFRALLHSTLCTKRVAEEFRLSTEAFEWLLGEIDARFQQA
NAM  O02452_MASGI/535-718
ASQ  LDGSAVE.FQSLPTLKPSNKAFEKRFRFDAAN-ERHLRRIFTE----DVVRDLLGSATALSELEKEWERLKKDREVLRTVFPT--.GDSKVVLPCNLQRMIWNAQKIFRVN.ARAPTDL.SPFRVIHGVEDLVKKLIIVPGE--.--DR...-.LSIQANENATLLFRALLRSTLCTKRVAEEFRLSSEAFEWLLGEIDTRFQQA
DSQ  CTGGATGGTTCTGCAGTAGAA...TTCCAGTCATTGCCTACACTCAAACCTTCAAATAAGGCTTTTGAAAAAAGATTCAGGTTTGATGCTGCTAAT---GAAAGGCACCTGAGACGAATATTCACAGAA------------GATGTAGTTCGTGATCTCTTAGGAAGTGCCACAGCCTTAAGCGAGCTGGAAAAGGAATGGGAAAGGCTAAAAAAAGATAGAGAAGTTTTGCGTACAGTTTTCCCAACT------...GGGGATAGCAAGGTGGTTCTACCCTGCAACTTGCAAAGAATGATTTGGAATGCCCAAAAAATTTTTCGTGTGAAT...GCAAGAGCACCAACAGACTTA...AGTCCATTTAGGGTTATTCATGGTGTTGAAGATCTTGTGAAAAAATTGATTATTGTACCAGGAGAG------...------GATAGA.........---...CTCAGTATTCAAGCAAATGAAAATGCAACATTGTTGTTTCGTGCATTGCTAAGATCCACTTTGTGTACCAAACGAGTTGCAGAAGAATTCAGATTATCATCTGAAGCCTTTGAATGGTTGCTTGGTGAAATTGATACAAGATTCCAGCAGGCA
TRN  10010101100011000
NAM  O02428_DYSCR/53-236
ASQ  LDGTMVE.FQSLPTLKPSDKAFEKRFKFDVTN-ERYLRRIFTD----DVIREISGSTTAISEFEREWDKLKTDRGILR-IIFPT-.GDSKVVLPCNLSRMIWNAQKIFHVN.TRAPTDL.SPIRVMKGVDELVKKLTIVAGE--.--DR...-.LSVQANDNATILFRALLHSTLCTKRVAEEFRLSVEAFEWLLGEIETRFQQA
NAM  Q9U5F6_EPTBU/395-578
ASQ  LAAEHVE.FQSLATLKPSNKAFEKKFKFDYTN-ERALLRCLHE----DVVSEVMSSAHIQNCLEREFEQIRDDREVLRAVFPT--.GDSKVVLPCNLQRMIWNAQKIFHIN.TRSSTDL.NPLRVVEGVNDLTQKLQIVKGD--.--DP...-.ISRQAQQNATLLFNCHVRATLCTRRLAEEHRLSSEAFEWLLGEIEAKFNHA
DSQ  CTTGCGGCGGAACATGTGGAG...TTCCAGAGCCTCGCCACACTCAAGCCTTCAAACAAGGCTTTTGAGAAGAAGTTCAAGTTTGACTATACAAAT---GAGCGTGCCCTGTTGCGTTGCCTGCACGAA------------GATGTCGTAAGCGAAGTGATGAGCAGTGCCCACATCCAGAACTGTCTGGAACGTGAGTTTGAGCAGATCCGCGATGACCGGGAGGTTCTGCGAGCTGTTTTCCCCACT------...GGTGACAGTAAGGTGGTTTTGCCCTGTAACCTCCAGCGAATGATCTGGAATGCTCAAAAGATCTTCCATATCAAT...ACCCGTTCCTCCACTGACCTC...AACCCACTGAGGGTTGTTGAAGGGGTCAATGACCTCACGCAGAAGTTGCAAATTGTCAAGGGAGAT------...------GATCCA.........---...ATCAGCCGACAGGCACAGCAGAATGCTACGCTTCTGTTCAACTGCCATGTGCGCGCGACGCTGTGCACACGCCGCCTGGCCGAGGAGCACAGACTTTCATCGGAAGCCTTTGAATGGCTTTTAGGAGAGATCGAAGCCAAGTTCAACCATGCT
TRN  10010101100011000
NAM  O35559_CRIGR/896-1079
ASQ  LAGESVE.FQNLATLKPSNKAFEKKFRFDYTN-ERALRRTLQE----DLVKDVLSNAHIQNELEREFERMREDREVLR-VIFPT-.GDSKVVLPCNLLRMIWNAQKIFHIN.PRLPSDL.HSIKVVEGVKELSKKLVIVNGD--.--DP...-.LSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQA
DSQ  CTAGCAGGCGAGAGCGTTGAG...TTCCAGAATCTGGCTACACTTAAACCCTCTAACAAAGCTTTCGAGAAGAAGTTCCGCTTTGATTACACCAAT---GAGAGGGCCCTGCGTCGCACACTACAGGAA------------GATCTGGTAAAGGACGTGCTGAGCAATGCACACATACAGAATGAGCTGGAACGGGAATTTGAGCGGATGCGAGAGGATCGGGAAGTGCTGAGG---GTCATCTTCCCAACT---...GGTGACAGCAAGGTGGTCCTCCCCTGTAACCTCCTTCGTATGATCTGGAATGCTCAGAAAATCTTCCACATCAAC...CCTCGACTTCCCTCTGACCTG...CACTCCATCAAAGTGGTAGAGGGAGTCAAGGAATTGAGCAAGAAGCTGGTAATTGTGAATGGGGAT------...------GACCCA.........---...CTAAGTCGGCAGGCCCAGGAGAATGCCACTTTGCTCTTCAACATCCACCTAAGATCCACACTCTGCTCTCGGCGCATGGCTGAGGAGTTTCGGCTAAGTGGAGAGGCCTTTGACTGGCTGCTTGGGGAGATAGAGTCCAAGTTCAACCAAGCC
TRN  10010101100011011
NAM  O08847_MOUSE/896-1079
ASQ  LAGESVE.FQNLATLKPSNKAFEKKFRFDYTN-ERALRRTLQE----DLVKDVLSNAHIQNELEREFERMREDREVLR-VIFPT-.GDSKVVLPCNLLRMIWNAQKIFHIN.PRLPSDL.HPIKVVEGVKELSKKLVIVNGD--.--DP...-.LSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQA
DSQ  CTGGCAGGGGAGAGTGTTGAG...TTCCAGAATCTGGCTACACTTAAACCTTCTAATAAAGCTTTTGAGAAGAAGTTCCGTTTTGATTATACCAAT---GAGAGGGCCCTGCGGCGCACCCTTCAGGAG------------GACCTGGTAAAGGATGTGCTGAGCAATGCCCATATACAGAATGAGCTGGAACGGGAATTTGAACGGATGCGTGAAGATCGGGAAGTGCTCAGG---GTCATCTTCCCAACT---...GGTGACAGCAAGGTGGTCCTCCCTTGTAACCTTCTGCGGATGATCTGGAATGCTCAGAAAATCTTCCACATCAAC...CCTCGCCTTCCCTCTGACCTG...CATCCCATCAAAGTGGTAGAGGGAGTCAAAGAATTGAGCAAGAAGTTGGTAATTGTGAATGGAGAT------...------GACCCA.........---...CTAAGTCGGCAGGCACAGGAGAATGCCACATTGCTCTTCAACATCCACCTAAGATCCACACTCTGCTCTCGCCGCATGGCTGAGGAGTTTCGGCTGAGTGGAGAGGCCTTTGACTGGCTGCTTGGGGAGATAGAGTCCAAGTTCAACCAAGCC
TRN  10010101100011011
NAM  RPB1_HUMAN/896-1079
ASQ  LAGESVE.FQNLATLKPSNKAFEKKFRFDYTN-ERALRRTLQE----DLVKDVLSNAHIQNELEREFERMREDREVLR-VIFPT-.GDSKVVLPCNLLRMIWNAQKIFHIN.PRLPSDL.HPIKVVEGVKELSKKLVIVNGD--.--DP...-.LSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQA
DSQ  CTGGCAGGCGAGAGCGTTGAG...TTCCAGAACCTGGCTACGCTTAAGCCTTCCAACAAGGCTTTTGAGAAGAAGTTCCGCTTTGATTATACCAAT---GAGAGGGCCCTGCGGCGCACTCTGCAGGAG------------GACCTGGTGAAGGACGTGCTGAGCAACGCACACATCCAGAACGAGTTGGAGCGGGAATTTGAGCGGATGCGGGAGGATCGGGAGGTGCTCAGG---GTCATCTTCCCAACT---...GGAGACAGCAAGGTCGTCCTCCCCTGTAACCTGCTGCGGATGATCTGGAATGCTCAGAAAATCTTCCACATCAAC...CCACGCCTTCCCTCCGACCTG...CACCCCATCAAAGTGGTGGAGGGAGTCAAGGAATTGAGCAAGAAGCTGGTGATTGTGAATGGGGAT------...------GACCCA.........---...CTAAGTCGACAGGCCCAGGAAAATGCCACGCTGCTCTTCAACATCCACCTGCGGTCCACGTTGTGTTCCCGCCGCATGGCAGAGGAGTTTCGGCTCAGTGGGGAGGCCTTCGACTGGCTGCTTGGGGAGATTGAGTCCAAGTTCAACCAAGCC
TRN  10010101100011011
NAM  RPB1_MOUSE/896-1079
ASQ  LAGESVE.FQNLATLKPSNKAFEKKFRFDYTN-ERALRRTLQE----DLVKDVLSNAHIQNELEREFERMREDREVLR-VIFPT-.GDSKVVLPCNLLRMIWNAQKIFHIN.PRLPSDL.HPIKVVEGVKELSKKLVIVNGD--.--DP...-.LSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQA
DSQ  CTGGCAGGGGAGAGTGTTGAG...TTCCAGAATCTGGCTACACTTAAACCTTCTAATAAAGCTTTTGAGAAGAAGTTCCGTTTTGATTATACCAAT---GAGAGGGCCCTGCGGCGCACCCTTCAGGAG------------GACCTGGTAAAGGATGTGCTGAGCAATGCCCATATACAGAATGAGCTGGAACGGGAATTTGAACGGATGCGTGAAGATCGGGAAGTGCTCAGG---GTCATCTTCCCAACT---...GGTGACAGCAAGGTGGTCCTCCCTTGTAACCTTCTGCGGATGATCTGGAATGCTCAGAAAATCTTCCACATCAAC...CCTCGCCTTCCCTCTGACCTG...CATCCCATCAAAGTGGTAGAGGGAGTCAAAGAATTGAGCAAGAAGTTGGTAATTGTGAATGGAGAT------...------GACCCA.........---...CTAAGTCGGCAGGCACAGGAGAATGCCACATTGCTCTTCAACATCCACCTAAGATCCACACTCTGCTCTCGCCGCATGGCTGAGGAGTTTCGGCTGAGTGGAGAGGCCTTTGACTGGCTGCTTGGGGAGATAGAGTCCAAGTTCAACCAAGCC
TRN  10010101100011011
NAM  Q9PTX4_LAMRE/395-578
ASQ  LAAEHVE.FQNLSTLKPSDKAFEKKYKFDFAN-ERAMRRCLQE----EVVNDIMSNAHIQNELDKEFDRVRSDRDTLRSVFPT--.GDSKVVLPCNLMRMIWNAQKIFHIN.TRQPTDI.NPLRIIEGVQDLSKRLMIVKGE--.--DP...-.LSRQAQENATLLLNCHVRSTLCARRVTEEFRLSLQAFEWLLGEIEARFNYA
DSQ  CTGGCGGCTGAGCACGTGGAG...TTCCAGAACCTCTCCACGCTGAAGCCCTCCGACAAGGCCTTCGAGAAGAAGTACAAGTTCGACTTTGCTAAC---GAGCGCGCCATGCGGCGCTGCCTGCAAGAG------------GAGGTGGTCAACGACATCATGAGCAACGCTCACATCCAGAACGAGCTGGACAAGGAGTTTGACCGCGTCCGCTCCGACAGGGACACGCTCCGCTCCGTGTTTCCCACG------...GGCGACAGCAAGGTGGTGCTGCCGTGCAACTTGATGCGCATGATCTGGAACGCTCAGAAGATCTTCCACATCAAC...ACGCGCCAGCCCACCGACATC...AACCCCCTGCGCATCATCGAAGGCGTCCAGGACCTGAGCAAGCGGCTGATGATCGTGAAAGGCGAG------...------GACCCG.........---...CTGAGTCGTCAGGCGCAGGAGAACGCCACGCTGCTGCTCAACTGCCACGTGCGCTCCACGCTGTGCGCTCGCCGCGTCACCGAGGAGTTCCGACTCTCCCTGCAGGCCTTCGAGTGGCTGCTAGGCGAGATCGAGGCACGCTTCAACTACGCC
TRN  10010101100011011
NAM  Q23699_CRAGI/807-990
ASQ  LDATHVE.FQTMPTLKPSNRAFERQFKFDATN-ERNMKKCLSE----EVIKDLMGDALAVSQLDREWEQLREDRDILRSIFPT--.GDSKVVLPCNLQRMIWNAQKIFRID.THKPTDL.HPIKVVEGVEDLCKRLIVVAGG--.--DR...-.LSIQANANATLLFKCLIRSTLCAKRVTEEFRLSSEAFEWLIGEVESRFQQA
NAM  Q25203_9CAEN/810-993
ASQ  LDACHVE.FQSLPTLKPSTRAFERQFRFDPTD-ERMMKRCLKE----DVIKGLRGEHRLIEELESEWLQLISDRDSARQVFST--.GDARIVLPCNLQRMIWNAQKIFRID.KRKPSDL.DPINVVSGVRDLCQRLTIVEGE--.--DM...-.ISKQANENATLLMKCLIRSTLCAKRVAEEHRLSEDAFNWLLGEIETRFQQA
DSQ  TTGGACGCCTGCCACGTGGAG...TTCCAGTCCCTGCCAACCCTTAAGCCCTCCACCCGCGCCTTCGAGCGCCAGTTCCGCTTCGACCCCACGGAC---GAGCGCATGATGAAGCGCTGCCTGAAGGAG------------GATGTGATCAAGGGGCTGAGGGGGGAGCACCGCCTGATAGAGGAGCTGGAGTCAGAGTGGCTGCAGCTGATCTCCGACCGCGACAGCGCCAGGCAGGTGTTCTCCACG------...GGCGATGCCCGCATCGTGCTCCCTTGCAACCTGCAGCGCATGATTTGGAACGCACAGAAGATCTTCCGCATCGAC...AAGCGAAAGCCCTCAGATCTG...GACCCAATCAACGTGGTGTCTGGCGTACGCGACCTGTGCCAGCGCCTAACCATCGTGGAAGGCGAG------...------GACATG.........---...ATCAGCAAGCAGGCCAACGAGAACGCCACTTTGCTCATGAAGTGCCTGATCCGCTCCACCCTGTGCGCCAAGAGGGTGGCCGAGGAGCACCGCCTGTCTGAGGATGCCTTCAACTGGCTGCTGGGTGAGATTGAGACTCGCTTCCAGCAGGCC
TRN  10010101100011001
NAM  Q25151_9ANNE/803-986
ASQ  LAGEWVE.FQNLPSLKPSNKAFEAGFKFDPTN-----EKHLKNYLDEDILKSLNGDANVIAEVESEYKQLLEDRTAIRQIFPS--.GDSKIVLPCNLQRLIWNAQKIFRIH.TRKPSNL.HPVKIIEDVRELSKKFMIVKGE--.--DR...-.LSKTANTNATLLMNILVRSTLCSKRVIEEFHLSTEAFEWLMGEIESKFIQA
NAM  P90678_9BILA/101-284
ASQ  LDGMWVE.NQTMPTMKPSNSLFERDFKMDLSD-ERTLKRLYTE----DVIRDVQSSSESIKEAELEWMQLQDDRQLLRK-IFPK-.GDAKIVLPCNLQRLIWNAQKIFHVE.TRKVTDL.NPVRVIQGVREVSKKLIIVGGD--.--DR...-.ISVQAQYNATLLMNILVRSTLCAKAMAEKHKLNAEAFEWLLGEIETRFQQA
DSQ  TTGGACGGCATGTGGGTGGAG...AATCAGACGATGCCGACAATGAAACCGTCGAATTCACTCTTCGAGAGAGACTTCAAGATGGATCTCTCCGAT---GAGAGAACACTCAAGAGACTCTACACTGAG------------GACGTCATCAGAGACGTGCAGAGCAGCTCAGAGAGCATCAAGGAGGCAGAGTTGGAGTGGATGCAACTGCAGGATGATCGACAATTGTTGAGGAAG---ATATTCCCCAAG---...GGAGATGCGAAGATTGTGCTGCCGTGCAATCTGCAGAGATTGATCTGGAATGCGCAGAAGATCTTCCACGTTGAG...ACGAGGAAGGTGACTGATCTG...AATCCCGTGCGTGTAATCCAAGGAGTGCGTGAAGTGTCGAAGAAGCTCATCATTGTGGGTGGCGAT------...------GATCGA.........---...ATCTCCGTGCAAGCACAGTACAATGCGACTCTGCTGATGAACATTCTCGTCCGATCCACTTTGTGCGCGAAGGCAATGGCAGAGAAGCACAAGTTGAATGCAGAAGCCTTCGAGTGGCTGCTGGGTGAGATTGAAACCCGCTTCCAGCAGGCC
TRN  10010101100011001
NAM  P91819_ZELPU/98-281
ASQ  LDGMWVE.AQTMPTMKPNNSLFEKQFKLDLTD-ERDLRRIYXD----SVVRELLGSADALREVESEWQQLEEDRRLLRK-IFPK-.GDAKVHLPCNLKRLIWNAHKIFHVD.LKKPVDL.NPLRVVEGVRELNKKLVIVSGE--.--DR...-.ISKQAQYNATLLMNILLRSTLCSKQVAKVHKLNTEAFEWILGEIETRFNQA
NAM  O01364_9BILA/101-284
ASQ  LDGMWVE.NQNLPTMKPTNAVFEKEFKLDLAD-EKTLRRFYTE----DVVRDLQGSSEALREVESEWAQLEEDRRLLRKIFPT--.GDAKIVLPCNLKRLLWNAQKIFHVE.MRKPTDL.NPLRVIEGVRELSKKLVIVGGE--.--DR...-.ISKQAQYNATLLMNILLRSTLCSKQMASHYKLNQEAFDWLLGEVETRFQQP
DSQ  CTCGACGGAATGTGGGTAGAG...AATCAGAACCTGCCGACAATGAAGCCCACAAACGCTGTCTTCGAGAAAGAATTCAAGCTCGACTTGGCGGAT---GAGAAAACGCTGCGTCGTTTCTACACTGAG------------GATGTGGTGCGCGATCTGCAAGGCTCCTCCGAAGCCCTTCGCGAAGTCGAATCCGAATGGGCTCAACTTGAGGAGGACCGTCGTTTGTTGAGGAAGATATTCCCGACC------...GGTGACGCGAAGATCGTGTTGCCTTGCAACTTGAAGCGTTTGCTCTGGAATGCACAAAAGATTTTCCACGTGGAG...ATGAGGAAGCCGACGGATCTG...AATCCGCTGCGTGTGATTGAGGGCGTACGCGAGCTGTCGAAGAAGCTTGTCATCGTAGGTGGTGAA------...------GATCGA.........---...ATCTCCAAACAGGCGCAATACAATGCCACGCTTCTCATGAATATCTTGCTGAGATCGACTCTTTGCTCGAAGCAAATGGCGTCTCATTACAAGCTCAATCAAGAGGCGTTCGACTGGCTACTCGGAGAAGTGGAGACGCGTTTCCAACAGCCT
TRN  10010101100011011
NAM  RPB1_CAEEL/886-1069
ASQ  LDGMWVE.NQNMPTMKPNNAVFERDFRMDLTD-NKFLRKNYSE----DVVREIQESEDGISLVESEWSQLEEDRRLLRKIFPR--.GDAKIVLPCNLQRLIWNAQKIFKVD.LRKPVNL.SPLHVISGVRELSKKLIIVSGN--.--DE...-.ISKQAQYNATLLMNILLRSTLCTKNMCTKSKLNSEAFDWLLGEIESRFQQA
DSQ  TTGGATGGAATGTGGGTTGAG...AATCAGAATATGCCGACGATGAAGCCCAATAATGCCGTGTTTGAGAGAGATTTCAGAATGGACCTCACCGAC---AACAAATTCCTTCGCAAAAACTACTCGGAA------------GACGTTGTGCGCGAAATTCAAGAATCCGAAGACGGAATTTCGCTCGTCGAATCGGAATGGTCACAGCTGGAAGAGGATCGTCGTCTCCTTCGAAAGATCTTTCCACGT------...GGTGACGCTAAGATCGTGCTTCCGTGTAATCTGCAGCGTCTCATTTGGAATGCTCAGAAAATATTCAAAGTTGAT...CTGCGCAAGCCGGTGAATCTC...TCGCCGTTGCACGTGATCTCCGGAGTCCGTGAGCTTTCGAAAAAGCTGATCATTGTCAGTGGAAAC------...------GACGAG.........---...ATTTCAAAGCAGGCTCAGTACAATGCGACACTTTTGATGAATATCTTGCTCCGTTCGACACTTTGCACCAAGAACATGTGCACAAAATCAAAACTGAACTCTGAAGCGTTCGATTGGCTCCTCGGAGAAATTGAATCGCGATTCCAACAGGCT
TRN  10010101100011001
NAM  O01376_9BILA/101-284
ASQ  LDGMWVE.NQSMPTMKPNNAVFERDFRTDLTD-HRFLENSYTE----DVIRELQESSEAIEKIESEWAQLSEDRRLLRK-IFPK-.GDAKIVLPCNLQRLMWNAQKIFKVD.TRKPVNL.SPLHVIDGVRELSKKLIIVCGN--.--DD...-.ISKQAQYNATLLMNILLRSALCTKKMCTSSKLNTEAFDWLLGEIESRFMQA
DSQ  TTGGATGGAATGTGGGTTGAG...AATCAGAGTATGCCAACGATGAAGCCGAATAATGCGGTATTTGAGAGGGATTTTAGAACGGATTTAACCGAT---CATCGATTCCTCGAAAATTCCTACACTGAA------------GATGTGATCCGAGAACTTCAAGAATCATCAGAAGCCATCGAAAAAATCGAATCCGAATGGGCTCAATTATCAGAAGATCGTCGATTATTGCGAAAA---ATCTTCCCAAAA---...GGCGACGCAAAAATTGTGCTACCCTGTAATCTCCAAAGACTCATGTGGAATGCTCAAAAGATTTTCAAAGTTGAC...ACCAGGAAACCGGTCAATTTA...TCACCTTTGCATGTAATTGATGGAGTTCGAGAATTGTCGAAAAAATTGATTATTGTATGTGGAAAT------...------GATGAT.........---...ATTTCGAAACAGGCACAATACAATGCGACACTTTTGATGAATATCCTATTGCGAAGCGCACTTTGCACCAAGAAAATGTGCACGAGCTCGAAATTGAACACGGAGGCTTTTGATTGGTTGTTGGGTGAAATTGAGTCGAGATTTATGCAGGCA
TRN  10010101110011000
NAM  O01375_9BILA/101-284
ASQ  LDAVWVE.GQTMPTMRLKNSVFEDLFKLDLTDEKTLRKLYTEE-----VVRDLLGSTVALKEAEEEWQQLEEDRRLLRK-IFPK-.GDNKVVLPCNLQRLIWNAQKIFKIE.TRKVTDL.SPVRVIEGIRELSKKLVIVSGE--.--DR...-.ISKQAQYNATLLMNILIRSTLCSKRVASMHKLNNEAFDWLLGEIEHRFKQA
DSQ  CTTGACGCTGTATGGGTGGAA...GGTCAAACAATGCCCACTATGAGACTGAAAAACAGTGTCTTTGAGGATCTATTTAAGCTTGATCTTACTGATGAGAAGACTTTGCGAAAATTATACACTGAAGAG---------------GTTGTGCGAGATCTTCTCGGTAGTACGGTGGCACTTAAAGAAGCTGAAGAGGAGTGGCAGCAGTTAGAGGAAGATCGGCGACTGTTACGAAAA---ATATTCCCGAAA---...GGCGACAACAAAGTCGTGCTGCCTTGCAATCTTCAACGTCTCATATGGAATGCGCAAAAAATTTTCAAAATTGAA...ACTCGAAAGGTTACTGATCTC...AGTCCTGTAAGGGTTATCGAAGGAATTCGTGAATTATCTAAGAAACTGGTTATTGTGTCCGGTGAA------...------GATCGT.........---...ATTTCAAAACAAGCTCAATATAATGCCACTCTTCTAATGAACATTTTGATCAGATCCACGTTATGCTCCAAACGGGTGGCTTCAATGCACAAACTGAATAATGAAGCTTTTGACTGGCTTTTAGGAGAAATCGAACATCGATTCAAGCAAGCA
TRN  10010101100011000
NAM  O01370_9BILA/101-284
ASQ  LDGTWVE.GQVMATMKLPHSAFEKQFKLDLSD-IKALQKVYNE----DIIRDLTGSTVALKEAEEEWERLEDDRRLLRK-IFPK-.GDKKVVLPCNLQRLIWNAQKIFKVE.TRKPTNL.SPLRVIEGVRELSKKLIIVSGD--.--DR...-.ISQQAQYNATLLMNILLRSTLCSKQMAEKYRLNQEGFEWLLGEIEHRFQQA
DSQ  CTTGATGGAACCTGGGTGGAG...GGACAAGTCATGGCAACAATGAAACTCCCACACAGCGCTTTTGAAAAACAATTTAAACTCGACCTGAGCGAC---ATCAAGGCTCTACAAAAAGTGTATAATGAG------------GACATTATCAGGGATCTTACCGGATCTACCGTTGCACTTAAAGAAGCCGAAGAAGAATGGGAAAGGCTTGAGGATGATCGCCGTTTGTTGAGAAAG---ATTTTCCCAAAA---...GGTGACAAGAAGGTTGTACTGCCGTGCAACTTACAACGCCTCATTTGGAATGCACAAAAGATCTTCAAAGTGGAA...ACGAGGAAGCCAACGAACTTG...AGTCCACTCAGAGTGATTGAAGGCGTTCGTGAGCTCTCAAAGAAGCTGATCATTGTATCTGGCGAC------...------GATCGC.........---...ATCTCTCAACAAGCTCAATATAATGCGACTCTTTTGATGAACATTCTGCTCCGATCTACTCTCTGCTCGAAACAGATGGCCGAAAAGTACAGACTGAATCAAGAAGGATTTGAATGGTTGTTGGGTGAGATTGAACATCGTTTCCAACAAGCG
TRN  10010101100011000
NAM  Q9BMP3_MONBE/814-997
ASQ  MDGACLE.KQGLPTLTPSDQGFER----DFCNTGNKL-ASLRQYLVGNIVDDINADDEMLQELEDEWQRLQDDRQFLRSVFPK--.GEADVVLPVQLRRLIISAQKEFNID.PRRPTDL.SPAHVAQAIRTFTDRLVVIPGD--.--DP...-.LSKVAQRNATLLFNCNLRSVLSSRQCIVRHRLNTKAFDWILGEVEKRFMQA
DSQ  ATGGACGGCGCGTGTCTTGAA...AAACAGGGCCTGCCCACGCTCACGCCCAGTGACCAGGGCTTTGAGCGC------------GACTTCTGTAACACGGGCAACAAGCTA---GCCTCACTGCGCCAGTACTTGGTGGGCAACATTGTCGACGATATCAACGCAGACGATGAAATGCTTCAGGAGCTCGAGGACGAGTGGCAACGCCTCCAAGACGACCGCCAGTTTTTGCGCTCCGTGTTTCCCAAG------...GGTGAAGCCGACGTGGTTCTTCCTGTGCAACTCCGGCGCCTCATTATCAGTGCGCAAAAGGAGTTTAACATTGAT...CCCCGGCGCCCTACGGACCTC...TCTCCCGCTCACGTGGCTCAGGCAATCCGTACCTTTACGGACCGCCTCGTGGTCATTCCTGGTGAC------...------GACCCT.........---...TTGAGCAAGGTGGCGCAGCGCAACGCCACCCTGCTTTTCAATTGCAACTTGCGCTCAGTCCTGTCCTCGCGACAGTGCATTGTGCGCCACCGCCTCAACACCAAGGCCTTCGATTGGATCCTTGGTGAGGTGGAGAAGCGCTTCATGCAGGCA
TRN  11011101101011001
NAM  RPB1_DICDI/57-250
ASQ  IDGCFVE.NQSIDSLRKDNTELERMYRHQVDK-----PDYGDGWMDPLVIEHVRNDSLTRDTLEKEFERIKSDRSLLRNEIIPS-.GEANWPLPVNLRRLINNAQKLFNID.IRRVSDL.NPAVVVLEIEKLVARLKIIATADTtEDDEn.fNrAWAEVYFNATMLFSILVRSTFASKRVLTEFRLTEKAFLWVCGEIESKFLQA
DSQ  ATAGATGGTTGTTTTGTTGAG...AATCAATCCATTGATTCCCTTAGAAAAGATAATACCGAATTGGAACGTATGTATCGTCATCAAGTTGATAAA---------------CCAGACTATGGTGATGGTTGGATGGATCCATTGGTAATTGAACATGTTAGAAACGATTCATTAACTCGTGATACATTGGAGAAAGAATTTGAACGTATTAAATCGGATCGTTCATTATTAAGAAATGAAATTATACCATCT---...GGTGAGGCAAATTGGCCATTACCAGTGAATTTACGTCGTTTAATTAATAATGCACAAAAACTTTTCAATATTGAT...ATTCGTAGAGTTAGTGATTTA...AATCCGGCAGTTGTTGTTTTAGAAATTGAAAAATTGGTAGCACGTTTAAAGATTATTGCAACCGCTGATACAaccGAAGATGATGAAaac...tttAATcgtGCTTGGGCTGAAGTTTACTTTAATGCCACAATGTTATTCTCGATTTTAGTACGTTCAACATTTGCAAGTAAACGTGTTTTAACCGAATTTAGATTAACAGAGAAAGCATTCCTTTGGGTTTGTGGTGAAATCGAAAGTAAATTCCTTCAAGCA
TRN  10010101110011000
NAM  RPB1_ARATH/893-1077
ASQ  MDAVWIE.SQKLDSLKMKKSEFDRTFKYEIDD--ENWNPTYLS--DEHLED-LKGIRELRDVFDAEYSKLETDRFQLGTEIATN-.GDSTWPLPVNIKRHIWNAQKTFKID.LRKISDM.HPVEIVDAVDKLQERLLVVPGD--.--DA...-.LSVEAQKNATLFFNILLRSTLASKRVLEEYKLSREAFEWVIGEIESRFLQS
DSQ  ATGGATGCTGTATGGATAGAA...TCACAGAAGCTGGATTCCTTGAAAATGAAGAAATCAGAGTTTGATAGGACTTTTAAGTATGAGATTGACGAC------GAAAACTGGAATCCTACTTACCTAAGT------GATGAACATCTTGAAGAC---TTGAAGGGGATTCGGGAGTTGCGTGATGTATTCGATGCGGAATATTCGAAACTTGAGACTGACAGATTCCAACTCGGGACAGAAATTGCAACAAAT---...GGTGATAGCACTTGGCCATTGCCTGTTAACATCAAGAGGCATATCTGGAATGCGCAGAAGACTTTCAAAATTGAC...TTGCGCAAAATTTCAGATATG...CACCCTGTTGAAATTGTTGATGCTGTTGATAAACTACAGGAGAGGCTGTTGGTTGTTCCTGGTGAT------...------GATGCG.........---...TTGAGTGTGGAAGCACAGAAAAACGCAACATTGTTCTTTAACATTTTGCTTCGCAGCACTCTTGCTAGTAAAAGAGTGTTGGAAGAATACAAGCTCAGCCGCGAGGCTTTTGAGTGGGTCATTGGTGAGATTGAATCAAGGTTTTTACAATCG
TRN  10010101100011000
NAM  Q99368_SOYBN/83-267
ASQ  MDAIWIE.TQKLDTLKMKKTEFDRVFRYEFDEENWKPNYMLQE-----PVEDLKTIREFRNVFEAEVQKLEADRHQLAIEIASN-.GDNSLPLPVNLKRLIWNAQKTFKVD.FRRPSDM.HPMEIVEAIDKLQERLKVVPGE--.--DA...-.LSQEAQKNATLLFNILLRSTFASKRVLEEYRLSRESFEWVVGEIESRFLQS
DSQ  ATGGACGCTATTTGGATTGAA...ACACAGAAGCTGGATACCCTTAAAATGAAGAAAACAGAATTTGATAGGGTGTTTAGGTATGAATTTGACGAGGAAAACTGGAAGCCTAATTACATGCTTCAAGAG---------------CCTGTAGAAGACTTGAAAACCATCAGAGAGTTTCGTAATGTGTTTGAGGCAGAAGTTCAAAAGCTTGAAGCTGATAGACATCAACTCGCAATAGAGATAGCCTCTAAT---...GGTGACAATTCTCTGCCACTGCCTGTTAACCTCAAGAGGCTTATCTGGAATGCTCAGAAGACATTTAAGGTTGAC...TTCCGAAGGCCTTCTGATATG...CATCCAATGGAAATTGTGGAAGCCATCGATAAGCTCCAGGAGCGGCTTAAGGTTGTTCCCGGCGAG------...------GACGCC.........---...TTGAGTCAAGAAGCTCAAAAGAATGCTACTCTCCTCTTCAATATTCTGCTCCGCAGCACTTTCGCCAGTAAAAGGGTCTTGGAGGAATACAGGCTTTCTCGCGAGTCATTTGAGTGGGTAGTCGGAGAAATAGAATCAAGGTTCTTGCAGTCG
TRN  10010101100011001
NAM  O00820_ACACA/802-986
ASQ  MDGQTVE.TQPLDALKMSNEGVVLKYQHDYDS-----PSWGEGWIDPVIADAIANSPEKKRILDKEFEQILADRRLLREKIFLA-.GDDRWPLPVNLTRMILNAQKIFHLG.PKKVSDL.DPCQIVEDLGNLIERLVVIPGQ--.--DD...-.ISKEAQANAILLFSILLRFTLASRRVLQEYRLDQISWDWLLGEITDRFYKS
DSQ  ATGGACGGGCAGACGGTCGAG...ACCCAGCCGCTCGACGCGCTCAAGATGTCGAACGAGGGCGTGGTCCTCAAGTACCAGCACGACTACGACTCG---------------CCCAGCTGGGGCGAGGGCTGGATCGACCCGGTCATCGCCGACGCCATCGCCAACTCGCCCGAGAAGAAGCGCATCCTCGACAAGGAATTCGAACAGATCCTTGCGGACAGGCGTCTGCTCCGAGAGAAGATCTTCCTTGCC---...GGTGACGACAGGTGGCCGCTGCCCGTAAACCTCACCAGGATGATTCTCAACGCCCAGAAGATCTTCCACCTTGGT...CCGAAGAAGGTGAGCGACCTC...GATCCGTGCCAGATCGTCGAAGATCTGGGCAACTTGATCGAGAGGTTGGTGGTGATTCCCGGCCAG------...------GACGAC.........---...ATCAGTAAGGAGGCGCAGGCCAACGCCATCCTGCTGTTCTCCATCCTGCTGCGATTCACGCTTGCGTCGCGTAGAGTGCTCCAGGAGTACCGGCTCGACCAGATCTCGTGGGATTGGTTGCTGGGTGAGATCACGGATCGGTTCTACAAGTCG
TRN  10010101100011011
NAM  Q27095_TRIVA/891-1076
ASQ  LDATGLE.TQRLALVTLNDEDFMKKYH--LATEDPTFGQV--E-MDDFVLDEFLKTPNKDKFLKEEENRLREYREILQKEIFPN-.GSNTVVVPVNIARIIESSQRQFDINvHVSKSDL.NPLDIISRVDECVNSLIVVKGN--.--DN...-.ISRTEQENATLLLRIMLYSHLSAKQCIFEYRLNEQAFKYILGSIKDRFYRS
DSQ  TTAGATGCAACAGGTTTGGAG...ACACAGAGGTTGGCATTAGTCACTCTAAATGATGAGGATTTCATGAAGAAATACCAT------CTCGCTACGGAAGATCCAACATTCGGTCAAGTT------GAA---ATGGACGATTTCGTTCTCGATGAATTCCTTAAGACACCGAACAAAGACAAGTTCCTCAAGGAAGAAGAGAACAGACTCAGGGAGTACAGAGAAATCCTTCAGAAGGAAATCTTCCCCAAC---...GGCTCAAACACAGTCGTTGTTCCTGTAAACATCGCTCGTATCATCGAATCTTCACAGCGTCAGTTCGATATCAATgtcCACGTCTCCAAATCAGATCTC...AACCCTCTCGATATCATTTCCCGTGTCGATGAATGCGTCAACTCTCTCATTGTCGTCAAAGGAAAT------...------GATAAC.........---...ATCTCTCGTACAGAACAAGAGAATGCAACTCTTCTTCTCAGGATCATGCTTTACTCCCATCTTTCCGCCAAACAATGCATCTTTGAGTACAGACTCAATGAACAAGCCTTCAAGTACATCTTGGGTTCAATCAAGGATAGATTCTACAGATCT
TRN  10010101110011000
NAM  Q9NJR9_LEIDO/852-1054
ASQ  LDGARIEgNQAFPIPHMTNSEMADKYRYEYNDEGSFSENMGGHYMDPFVRDSLLRDPQSVLKVQEEFEQLMKDRAMSRLVIDMEDkNKLKMNLPVNVARLIQNARTTMGKR.-SQVSNLnRITTVINRVRELQEDLVQLFPSYHkDYSGrfaNvLSQQRVERALTLFGIHLRQILGSKRVLKEYKLNDKAFEYLLKEIRTKYQES
DSQ  CTGGACGGTGCTCGCATTGAGggcAACCAAGCCTTCCCGATCCCGCACATGACGAACAGTGAGATGGCTGACAAGTACCGCTACGAGTACAACGACGAGGGCAGCTTCTCGGAGAACATGGGCGGCCATTACATGGATCCGTTTGTGCGCGACTCGCTGCTGCGCGACCCGCAGAGCGTGCTGAAGGTGCAGGAGGAGTTCGAGCAGCTGATGAAGGATCGCGCGATGTCGCGGCTCGTTATTGACATGGAGGACaagAACAAGCTCAAGATGAACCTGCCCGTGAACGTCGCGCGGCTCATTCAGAACGCGCGCACGACGATGGGTAAGCGC...---AGCCAGGTATCCAACCTGaacCGGATCACTACTGTGATCAACCGCGTGCGGGAGCTGCAGGAGGACCTCGTGCAGCTGTTCCCGTCCTACCACaagGACTACAGCGGCcgcttcgctAATgtgCTGAGCCAGCAGCGCGTGGAGCGGGCCCTCACGCTCTTTGGCATCCACTTGCGCCAGATTCTCGGCTCGAAACGGGTGCTGAAGGAGTACAAGTTGAATGACAAGGCGTTTGAGTACCTGCTGAAGGAGATCCGCACCAAGTACCAGGAGTCC
TRN  11011101101011011
NAM  Q9GP01_LEIGU/33-232
ASQ  LDGARID.NQAFPIPHMTNCELVDKYRYEYNDEGSFSENMGGHYMDPFVRDSLLRDPQRLLKLQEEFDQLVKDRAMSXLVIDMEDkNKLKMNLPVNVARLIQNARTTMGKR.-SQVSNL.NPITVINRV-ELQEDLVQLFPSYHkDYNGrfiNvLSQQRVERALTLFGIHLRQVLGSKRVLKEYKLNDKAFEYLLKEIRTKYQQS
NAM  O15678_LEIBR/43-244
ASQ  LDGAPIEgNQAFPIPHMTNCELVDKYRYEYNDEGSFSENMGGHYMDPFVRDSLLRDPQSVLKLQEEFDQLVKDRAMSRLVIDMEDkNKLKMNLPVNVARLIQNARTTMGKR.-SQVSNL.NPITVINRVRELQEDLVQLFPSYHkDYNGrfvNvLSQQRVERALTLFGIHLRQVLGSKRVLKEYKLNDKAFEYLLKEIRTKYQQS
DSQ  CTGGACGGTGCCCCCATTGAGggcAACCAGGCCTTCCCGATCCCGCACATGACCAACTGTGAGCTGGTCGACAAGTACCGCTACGAGTACAACGACGAGGGTAGCTTCTCGGAGAACATGGGCGGCCATTACATGGATCCGTTTGTACGTGACTCGCTGCTACGCGACCCGCAGAGCGTGCTGAAGCTGCAAGAGGAGTTCGACCAACTGGTGAAGGATCGCGCGATGTCGCGCCTCGTTATCGACATGGAAGACaagAACAAGCTCAAGATGAACCTCCCCGTGAACGTAGCGCGGCTCATTCAGAACGCGCGCACGACGATGGGTAAGCGC...---AGCCAGGTGTCCAACCTA...AACCCGATCACTGTGATCAACCGCGTGCGGGAGCTGCAGGAGGACCTCGTGCAGCTGTTCCCGTCCTACCACaaaGACTACAACGGTcgcttcgttAATgtgCTGAGCCAGCAGCGTGTGGAGCGGGCCCTGACGCTCTTCGGCATTCACCTGCGCCAGGTCCTCGGCTCGAAGCGGGTGCTGAAGGAGTACAAGCTGAACGACAAGGCGTTCGAGTACTTGCTAAAGGAAATCCGCACCAAGTACCAGCAGTCC
TRN  11011101101011011
NAM  Q25382_9TRYP/43-244
ASQ  LDGARIEgNQAFPIPHMTNCELVDKYRYEYNDEGSFSENMGGHYMDPFVRDSLLRDPQSVLKLQEEFDQLVKDRAMSRLVIDMEDkNKLKMNLPVNVARLIQNARTTMGKR.-SQVSNL.NPITVINRVRELQEDLVQLFPSYHkDYNGrfvNvLSQQRVERALTLFGIHLRQVLGSKRVLKEYKLNDKAFEYLLKEIRTKYQQS
DSQ  CTGGACGGTGCCCGAATTGAGggcAACCAGGCCTTCCCGATCCCGCACATGACCAACTGTGAGCTTGTCGACAAGTACCGCTACGAGTACAACGACGAGGGCAGCTTCTCGGAGAACATGGGCGGCCATTACATGGATCCGTTTGTACGTGACTCGCTGCTACGCGACCCGCAGAGCGTGCTGAAGTTGCAAGAGGAGTTCGACCAACTGGTGAAGGATCGCGCGATGTCGCGCCTCGTTATCGACATGGAAGACaagAACAAGCTCAAGATGAACCTCCCCGTGAACGTAGCGCGGCTCATCCAGAACGCGCGCACGACGATGGGTAAGCGC...---AGCCAGGTGTCCAACCTA...AACCCGATCACTGTGATCAACCGCGTGCGGGAGCTGCAGGAGGACCTCGTGCAGCTGTTTCCCTCCTACCACaaaGACTACAACGGTcgcttcgttAATgtgCTGAGCCAGCAGCGTGTGGAGCGGGCCCTGACGCTCTTCGGCATTCACCTGCGCCAGGTCCTCGGCTCGAAGCGGGTGCTGAAGGAGTACAAGCTGAACGACAAGGCGTTCGAGTACTTGCTAAAGGAAATCCGCACCAAGTACCAGCAGTCC
TRN  11011101101011011
NAM  Q9GNZ5_LEIMA/30-230
ASQ  LDGARIEgNQAFPIPHMTNSEMADKYRYEYNDEGSFSENMGGHYMDPFVRDSLLADPQRLLKLQEEFEQLMRDRAMSXLVIDMEDkNKLKMNLPVNVARLIQNAGTTMGKR.-SQVSNL.NPITVINRV-ELQEDLVQLFPSYHkDYNGrfvNvLSQQRVERALTLFGIHLRQILGSKRVLKEYKLNDKAFEYLLKEIRTKYQQS
NAM  Q9GNX2_9TRYP/31-232
ASQ  LDGARIEgNQAFPIPHMTNSEMADKYRYEYNDEGSFSENMGGHYMDPFVRDSLLRDPQRLLKLQEEFEQLMKDRAMSXLVIDMEDkNKLKMNLPVNVARLIQNARTTMGKR.-SQVSNL.NPITVINRVRELQEDLVQLFPSYHkDYNGrfvNvLSQQRVERALTLFGIHLRQILGSKRVLKEYKLNDKAFEYLLKEIRTKYQQS
NAM  Q9GP03_9TRYP/31-232
ASQ  LDGARIEgNQAFPIPHMTNSEMADKYRYEYNDEGSFSENMGGHYMDPFVRDSLLRDPQRLLKLQEEFEQLMKDRAMSXLVIDMEDkNKLKMNLPVNVARLIQNARTTMGKR.-SQVSNL.NPITVINRVRELQEDLVQLFPSYHkDYNGrfvNvLSQQRVERALTLFGIHLRQILGSKRVLKEYKLNDKAFEYLLKEIRTKYQQS
NAM  Q25223_LEIAM/43-244
ASQ  LDGARIEgNQAFPIPHMTNSEMADKYRYEYNDEGSFSENMGGHYMDPFVRDSLLRDPQSVLKLQEEFDQLMKDRAMSRLVIDMEDkNKLKMNLPVNVARLIQNARTTMGKR.-SQVSNL.NPITVINRVRELQEDLVQLFPSYHkDYNGrfvNvLSQQRVERALTLFGIHLRQILGSKRVLKEYKLNDKAFEYLLKEIRTKYQQS
DSQ  CTGGACGGTGCCCGTATTGAGggcAACCAGGCCTTCCCGATCCCGCACATGACGAACAGTGAGATGGCTGACAAGTACCGCTACGAGTACAACGACGAGGGCAGCTTCTCCGAGAACATGGGCGGCCATTACATGGATCCGTTTGTGCGCGACTCGCTGCTGCGTGACCCGCAGAGTGTGTTGAAGTTGCAGGAGGAGTTTGACCAGCTGATGAAGGATCGCGCGATGTCGCGCCTCGTTATCGACATGGAGGACaagAACAAGCTCAAGATGAACCTGCCCGTGAACGTCGCGCGGCTTATCCAGAACGCGCGCACGACGATGGGTAAACGC...---AGTCAGGTGTCCAATCTG...AACCCGATAACTGTGATCAACCGCGTGCGGGAGCTGCAGGAGGACCTGGTGCAGCTGTTTCCATCCTACCACaagGATTACAACGGCcgcttcgtgAATgttCTGAGCCAGCAGCGCGTGGAGCGGGCCCTAACGCTCTTTGGCATTCACCTGCGCCAGATCCTCGGCTCGAAGCGGGTGCTGAAGGAGTACAAGCTGAATGACAAGGCGTTTGAGTACCTGCTGAAGGAGATCCGCACGAAGTACCAGCAGTCC
TRN  10010101100011011
NAM  Q25311_LEIME/43-244
ASQ  LDGARIEgNQAFPIPHMTNSEMAEKYRYEYNDEGSFSENMGGHYMDPFVRDSLLRDPQSVLKLQEEFDQLMKDRAMSRLVIDMEDkNKLKMNLPVNVARLIQNARTTMGKR.-SQVSNL.NPITVINRVRELQEDLVQLFPSYHkDYNGrfvNvLSQQRVERALTLFGIHLRQILGSKRVLKEYKLNDKAFEYLLKEIRTKYQQS
DSQ  CTGGACGGTGCCCGTATTGAGggcAACCAGGCCTTCCCGATCCCGCACATGACGAACAGTGAGATGGCTGAGAAGTACCGCTACGAGTACAACGACGAGGGCAGCTTCTCCGAGAACATGGGCGGCCATTACATGGATCCGTTTGTGCGCGACTCGCTGCTGCGCGACCCGCAGAGTGTGTTGAAGTTGCAGGAGGAGTTTGACCAGCTGATGAAGGATCGCGCGATGTCGCGCCTCGTTATCGACATGGAGGACaagAACAAGCTCAAGATGAACCTGCCCGTGAACGTCGCGCGGCTTATCCAGAACGCGCGCACGACGATGGGTAAACGC...---AGTCAGGTGTCCAATCTG...AACCCGATAACTGTGATCAACCGCGTGCGGGAGCTGCAGGAGGACCTCGTGCAGCTGTTTCCATCCTACCACaagGATTACAACGGCcgcttcgtgAATgtgCTGAGCCAGCAGCGCGTGGAGCGGGCCCTAACGCTCTTTGGCATTCACCTGCGCCAGATCCTCGGCTCGAAGCGGGTGCTGAAGGAGTACAAGCTGAACGACAAGGCGTTTGAGTACCTGCTGAAGGAGATCCGCACGAAGTACCAGCAGTCC
TRN  10010101100011011
NAM  Q25268_LEIDO/43-244
ASQ  LDGARIEgNQAFPIPHMTNSEMADKYRYEYNDEGSFSENMGGHYMDPFVRDSLLRDPQSVLKLQEEFEQLMKDRAMSRLVIDMEDkNKLKMNLPVNVARLIQNARTTMGKR.-SQVSNL.NPITVINRVRELQEDLVQLFPSYHkDYNGrfaNvLSQQRVERALTLFGIHLRQILGSKRVLKEYKLNDKAFEYLLKEIRTKYQQS
DSQ  CTGGACGGTGCTCGTATTGAGggcAACCAAGCCTTCCCGATCCCGCACATGACGAACAGTGAGATGGCTGACAAGTACCGCTACGAGTACAACGACGAGGGCAGCTTCTCGGAGAACATGGGCGGCCATTACATGGATCCGTTTGTGCGCGACTCGCTGCTGCGCGACCCGCAGAGCGTGTTGAAGCTGCAGGAGGAGTTCGAGCAGCTGATGAAGGATCGCGCGATGTCGCGGCTCGTTATTGACATGGAGGACaagAACAAGCTCAAGATGAACCTGCCCGTGAACGTCGCGCGGCTCATCCAGAACGCGCGCACGACGATGGGTAAGCGC...---AGCCAGGTATCCAACCTG...AACCCGATCACTGTGATCAACCGCGTGCGGGAGCTGCAGGAGGACCTCGTGCAGCTGTTCCCGTCCTACCACaagGACTACAACGGCcgcttcgctAATgtgCTGAGCCAGCAGCGCGTGGAGCGGGCCCTCACGCTCTTTGGCATCCACTTGCGCCAGATCCTCGGCTCGAAGCGGGTGCTGAAGGAGTACAAGCTGAATGACAAGGCGTTTGAGTACCTGCTGAAGGAGATCCGCACCAAGTACCAGCAGTCC
TRN  11011111101111111
NAM  Q25312_LEIMA/853-1054
ASQ  LDGARIEgNQAFPIPHMTNSEMADKYRYEYNDEGSFSENMGGHYMDPFVRDSLLRDPQSVLKLQEEFEQLMKDRAMSRLVIDMEDkNKLKMNLPVNVARLIQNARTTMGKR.-SQVSNL.NPITVINRVRELQEDLVQLFPSYHkDYNGrfvNvLSQQRVERALTLFGIHLRQILGSKRVLKEYKLNDKAFEYLLKEIRTKYQQS
NAM  O15680_LEITR/43-244
ASQ  LDGARIEgNQAFPIPHMTNSEMADKYRYEYNDEGSFSENMGGHYMDPFVRDSLLRDPQSVLKLQEEFEQLMKDRAMSRLVIDMEDkNKLKMNLPVNVARLIQNARTTMGKR.-SQVSNL.NPITVINRVRELQEDLVQLFPSYHkDYNGrfvNvLSQQRVERALTLFGIHLRQILGSKRVLKEYKLNDKAFEYLLKEIRTKYQQS
DSQ  CTGGACGGTGCTCGCATTGAGggcAACCAGGCCTTCCCGATCCCGCACATGACGAACAGTGAGATGGCTGACAAGTACCGCTACGAGTACAACGACGAGGGCAGCTTCTCGGAGAACATGGGCGGCCATTACATGGATCCGTTTGTGCGCGACTCGCTGCTGCGCGACCCGCAGAGCGTGTTGAAGCTGCAGGAGGAGTTCGAGCAGCTGATGAAGGATCGCGCGATGTCGCGGCTCGTGATCGACATGGAGGACaagAACAAGCTCAAGATGAACCTGCCCGTGAACGTCGCGCGGCTCATCCAGAACGCGCGCACGACGATGGGCAAGCGC...---AGCCAGGTGTCCAATCTG...AACCCGATCACTGTGATCAACCGCGTGCGGGAGCTGCAGGAGGACCTCGTGCAGCTGTTCCCGTCCTACCACaagGACTACAACGGCcgcttcgttAATgtgCTGAGCCAGCAGCGCGTGGAGCGGGCCCTGACGCTCTTTGGCATCCACTTGCGCCAGATCCTCGGCTCGAAGCGGGTGCTGAAGGAGTACAAGCTGAACGACAAGGCGTTTGAGTACCTGCTGAAGGAGATCCGCACCAAGTACCAGCAGTCC
TRN  11011111101111111
NAM  O18710_9TRYP/43-244
ASQ  LDGARIEgNQAFPIPHMTNSEMADKYRYEYNDEGSFSENMGGHYMDPFVRDSLLRDPQSVLKLQEEYDQLVKDRAMSRLVIDMEDkNKLKMNLPVNVARLIQNARTTMGKR.-SQVSNL.NPITVINRVRELQEDLVQLFPSYHkDYNGrflNvLSQQRVERAVMLFGIHLRQILGSKRVLKEYKLNDKAFEYLLKEIRTKYQQS
DSQ  CTGGACGGTGCCAGAATTGAGgggAACCAGGCCTTTCCCATCCCGCACATGACGAACAGTGAGATGGCTGACAAGTATCGCTACGAGTACAACGACGAGGGCAGCTTCTCGGAGAACATGGGCGGGCATTACATGGATCCGTTTGTGCGGGACTCGCTGCTGCGCGACCCTCAGAGCGTGTTGAAGTTGCAGGAAGAGTACGACCAGCTGGTGAAGGACCGCGCAATGTCGCGACTTGTTATCGATATGGAGGACaagAACAAGCTCAAGATGAACCTGCCCGTGAACGTCGCGCGGCTTATTCAGAACGCGCGCACGACAATGGGTAAGCGC...---AGCCAGGTGTCCAACCTG...AACCCGATCACTGTGATCAACCGCGTGCGGGAGCTGCAGGAGGATCTCGTGCAGCTGTTCCCGTCCTACCACaagGACTACAACGGCcgcttcctgAATgtgCTGAGTCAGCAGCGTGTGGAGCGGGCTGTGATGCTCTTCGGCATTCACTTGCGTCAGATCCTCGGCTCGAAGCGGGTGCTGAAAGAGTATAAGCTGAACGACAAGGCGTTTGAGTACTTGCTGAAAGAGATCCGCACCAAGTACCAGCAGTCC
TRN  10010101100011011
NAM  O18713_9TRYP/43-244
ASQ  LDGARIEgNQAFPIPHMTNSEMADKYRYEYNDEGSFSENMGGHYMDPFVRDSLLRDPQSVLKLQEEYDQLVKDRAMSRLVIDMEDkNKLKMNLPVNVARLIQNARTTMGKR.-SQVSNL.NPITVINRVRELQEDLVQLFPSYHkDYNGrflNvLSQQRVERAVMLFGIHLRQILGSKRVLKEYKLNDKAFEYLLKEIRTKYQQS
DSQ  CTGGACGGTGCCAGAATTGAGgggAACCAGGCCTTTCCCATCCCGCACATGACGAACAGTGAGATGGCTGACAAGTATCGCTACGAGTACAACGACGAGGGCAGCTTCTCGGAGAACATGGGCGGGCATTACATGGATCCGTTTGTGCGGGACTCGCTGCTGCGCGACCCTCAGAGCGTGTTGAAGTTGCAGGAGGAGTACGACCAGCTGGTGAAGGACCGCGCAATGTCGCGACTTGTTATCGATATGGAGGACaagAACAAGCTCAAGATGAACCTGCCCGTGAACGTCGCGCGGCTTATTCAGAACGCGCGCACGACAATGGGTAAGCGC...---AGCCAGGTGTCCAACCTG...AACCCGATCACTGTGATCAACCGCGTGCGGGAGCTGCAGGAGGATCTCGTGCAGCTGTTCCCGTCCTACCACaagGACTACAACGGCcgcttcctgAATgtgCTGAGTCAGCAGCGTGTGGAGCGGGCTGTGATGCTCTTCGGCATTCACTTGCGCCAGATTCTCGGCTCGAAGCGGGTGCTGAAAGAGTACAAGCTGAACGACAAGGCGTTTGAGTACTTGCTGAAAGAGATCCGCACCAAGTACCAGCAGTCC
TRN  10010101100011011
NAM  O77439_9TRYP/43-244
ASQ  LDGARIEgNQAFPIPHMTNSEMADKYRYEYNDEGSFSENMGGHYMDPFVRDSLLRDPQSVLKLQEEYDQLVKDRAMSRLVIDMEDkNKLKMNLPVNVARLIQNARTTMGKR.-SQVSNL.NPITVINRVRELQEDLVQLFPSYHkDYNGrflNvLSQQRVERAVMLFGIHLRQILGSKRVLKEYKLNDKAFEYLLKEIRTKYQQS
DSQ  CTGGACGGTGCCAGAATTGAGgggAACCAGGCCTTTCCCATCCCGCACATGACGAACAGTGAGATGGCTGACAAATATCGCTACGAGTACAACGACGAGGGCAGCTTCTCGGAGAACATGGGCGGGCATTACATGGATCCGTTTGTGCGGGACTCGCTGCTGCGCGACCCTCAGAGCGTGTTGAAGTTGCAGGAAGAGTACGACCAGCTGGTGAAGGACCGCGCAATGTCGCGACTTGTTATCGATATGGAGGACaagAACAAGCTCAAGATGAACCTGCCCGTGAACGTCGCGCGGCTTATTCAGAACGCGCGCACGACAATGGGTAAGCGC...---AGCCAGGTGTCCAACCTG...AATCCCATCACTGTGATCAACCGCGTGCGGGAGCTTCAGGAGGATCTAGTGCAGCTGTTCCCGTCCTACCACaagGACTACAACGGCcgcttcctgAATgtgCTGAGTCAGCAGCGTGTGGAGCGGGCTGTGATGCTTTTCGGCATTCACTTGCGCCAGATCCTCGGCTCGAAGCGGGTGCTGAAAGAGTACAAGCTGAACGACAAGGCGTTTGAGTACTTGCTGAAAGAGATCCGCACCAAGTACCAGCAATCC
TRN  10010101100011011
NAM  O15679_LEITA/43-244
ASQ  LDGARIEgNQAFPIPHMANSEMADKYRYEYNDEGSFSENMGGHYMDPFVRDSLLRDPQSVLKLQEEYDQLMKDRAMSRLVIDMEDkNKLKMNLPVNVARLIQNARTTMGKR.-SQVSNL.NPITVINRVRELQEDLVQLFPSYHrDYNGrflNvLSQQRVERAVMLFGIHLRQILGSKRVLKEYKLNDKAFEYLLKEIRTKYQQS
DSQ  CTGGACGGTGCCAGAATTGAGgggAATCAGGCCTTTCCCATCCCGCACATGGCGAACAGTGAGATGGCTGACAAATATCGCTACGAGTACAACGACGAGGGCAGCTTCTCGGAGAACATGGGCGGGCATTACATGGATCCGTTTGTGCGGGACTCGCTGCTGCGCGACCCTCAGAGCGTGTTGAAGTTGCAGGAAGAGTACGACCAGCTGATGAAGGACCGCGCAATGTCGCGACTTGTTATCGATATGGAGGACaagAACAAGCTCAAGATGAACCTGCCGGTGAACGTCGCGCGGCTTATTCAGAACGCGCGCACGACAATGGGTAAGCGC...---AGCCAGGTGTCCAACCTG...AACCCGATCACTGTGATCAACCGCGTGCGGGAGCTTCAGGAGGATCTCGTTCAGCTGTTCCCGTCCTACCACaggGACTACAACGGCcgcttcctgAATgtgCTGAGTCAGCAGCGTGTGGAGCGGGCTGTGATGCTTTTCGGCATTCACTTGCGCCAGATCCTCGGCTCGAAGCGGGTGCTGAAAGAGTACAAGCTGAACGACAAGGCGTTTGAGTACTTGCTGAAAGAGATCCGCACCAAGTACCAGCAGTCC
TRN  10010101100011011
NAM  O18711_9TRYP/43-244
ASQ  LDGARIEgNQAFPIPHMTNCEMAEKYRYEYNDEGSFSENMGGHYMDPFVRDSLLRDPQSVLKLQEEFDQLMKDRATSRLVIDMEDkNKLKMNLLVNVARLIQNARTTMGKR.-SQVSNL.NPITVINRVRELQEDIIQLFPSYHkDYNGrftNvLSQQRVERAFTLFGIHLRQILGSKRVLKEYKLNDKAFEYLLKEIRTKYQQS
DSQ  CTGGACGGTGCTCGCATTGAAggcAATCAGGCCTTCCCTATTCCACACATGACGAACTGCGAGATGGCTGAGAAGTACCGCTACGAGTACAACGACGAGGGAAGCTTCTCCGAAAACATGGGCGGTCATTACATGGATCCGTTCGTGCGCGACTCACTGCTGCGCGACCCGCAAAGCGTGTTAAAGCTGCAGGAGGAGTTCGATCAACTGATGAAGGACCGCGCAACGTCGCGTTTGGTCATTGACATGGAGGACaaaAATAAACTCAAAATGAACTTGCTCGTGAACGTAGCGCGGCTCATCCAGAACGCGCGCACAACGATGGGTAAGCGC...---AGCCAGGTGTCTAATCTG...AACCCGATCACTGTCATCAACCGTGTGCGGGAGCTGCAGGAGGATATCATTCAACTGTTTCCATCTTACCACaagGATTACAACGGCcgatttacgAACgtgCTCAGTCAGCAGCGCGTGGAGCGGGCCTTCACGCTCTTCGGCATCCACCTGCGCCAGATTCTCGGCTCGAAGCGGGTGCTGAAGGAGTACAAACTGAACGACAAGGCTTTCGAGTACTTGCTGAAGGAAATACGCACCAAATATCAGCAGTCA
TRN  10010101100011000
NAM  Q25291_9TRYP/43-244
ASQ  LDGARIEgNQAFPIPHMTNCEMAEKYRYEYNDEGSFSENMGGHYMDPFVRDSLLRDPQSVLKLQEEFDQLMKDRATSRFVIDMEDkNKLKMNLPVNVARLIQNARTTMGKR.-SQVSNL.NPITVINRVRELQEDIVQLFPSYHkDYNGrftNvLSQQRVERAFTLFGIHLRQILGSKRVLKEYKLNDKAFEYLLKEIRTKYQQS
DSQ  CTGGACGGTGCTCGCATTGAAggcAATCAGGCCTTCCCTATTCCACACATGACGAACTGCGAGATGGCTGAGAAGTACCGCTACGAGTACAACGACGAGGGAAGCTTCTCCGAAAACATGGGCGGTCATTACATGGATCCGTTCGTGCGCGACTCACTGCTGCGCGACCCGCAAAGCGTGTTAAAGCTGCAGGAGGAGTTCGATCAACTGATGAAGGACCGCGCAACGTCGCGTTTTGTCATTGACATGGAGGACaaaAATAAACTCAAAATGAACTTGCCCGTGAACGTAGCGCGGCTCATCCAAAACGCGCGCACAACGATGGGTAAGCGC...---AGCCAGGTGTCTAACCTG...AACCCGATCACTGTCATCAACCGCGTGCGGGAGCTGCAGGAGGACATCGTTCAGCTGTTTCCATCTTACCACaagGATTACAACGGCcgatttactAACgtgCTCAGTCAGCAGCGCGTGGAGCGGGCCTTCACGCTCTTCGGCATCCACTTGCGCCAGATTCTCGGCTCGAAGCGGGTGCTGAAGGAGTACAAACTGAACGACAAGGCTTTCGAGTACTTGCTGAAGGAAATACGCACCAAATATCAGCAGTCG
TRN  10010101100011000
NAM  O18712_9TRYP/43-244
ASQ  LDGARIEgNQAFPIPHMTNCEMSDKYRYEYNDEGIFSENMGGHYMDPFVRDSLLRDPQSVLKLQGEFEQLMKDRATSRLVIDMEDkNKLKMNLPVNVARLIQNARTTMGKR.-SQVSNL.NPITVIDRVRQLQEDIVQLFPSYHkEYSGrftNlLSQQRVERALTLFGIHLRQILGSKRVLKEYRLNDKAFEYLLKEIRTKYQQS
DSQ  CTGGACGGAGCCCGCATTGAGggcAACCAGGCCTTCCCGATCCCGCACATGACGAACTGCGAGATGTCAGATAAATACCGCTACGAGTACAATGACGAGGGAATCTTTTCAGAAAACATGGGCGGTCACTATATGGATCCTTTTGTGCGCGACTCTCTCCTTCGCGACCCGCAAAGCGTGTTGAAGCTCCAGGGGGAGTTCGAGCAGCTGATGAAAGACCGCGCAACCTCGCGCCTCGTCATTGACATGGAGGACaagAACAAGCTCAAGATGAACCTGCCCGTGAACGTTGCGCGGCTTATTCAGAACGCGCGTACGACTATGGGTAAGCGC...---AGTCAGGTGTCGAACCTC...AACCCCATCACGGTCATCGACCGCGTGCGGCAGCTGCAGGAGGATATCGTGCAGCTGTTTCCATCCTATCATaagGAATACAGCGGCcgcttcacgAACttgCTCAGCCAGCAGCGCGTGGAGAGGGCCTTGACGCTTTTTGGGATTCACTTGCGCCAGATTCTCGGATCCAAACGTGTGCTGAAGGAGTACAGATTGAACGATAAGGCGTTTGAGTACTTGCTAAAGGAGATCCGAACCAAGTACCAGCAGTCA
TRN  10010101100011001
NAM  Q25290_9TRYP/43-244
ASQ  LDGARIEgNQAFPIPHMTNCEMADKYRYEYNDEGTFSENMGGHYMDPFVRDSLLRDPQSVLKLQGEFEQLMKDRATSRLVIDMEDkNKLKMNLPVNVARLIQNARTTMGKR.-SQVSNL.NPITVIDRVRQLQEDIVQLFPSYHkEYSGrftNlLSQQRVERALTLFGIHLRQILGSKRVLKEYRLNDKAFEYLLKEIRTKYQQS
DSQ  TTGGACGGAGCTCGCATTGAGggcAACCAGGCCTTCCCGATCCCCCACATGACGAACTGCGAGATGGCGGATAAATACCGCTACGAGTACAATGACGAAGGAACCTTCTCAGAAAACATGGGCGGTCACTATATGGATCCTTTTGTGCGCGACTCTCTCCTTCGCGATCCGCAAAGCGTGTTGAAGCTGCAGGGGGAGTTCGAGCAGCTGATGAAAGACCGCGCAACCTCGCGCCTCGTCATCGACATGGAGGACaaaAACAAGCTCAAGATGAATCTTCCCGTGAACGTTGCGCGACTTATTCAGAACGCGCGTACGACTATGGGTAAGCGC...---AGCCAGGTGTCGAACCTG...AACCCAATCACTGTCATTGACCGCGTGCGGCAGCTGCAGGAGGATATCGTGCAACTGTTTCCCTCCTATCACaagGAATACAGCGGCcgcttcacgAACttgCTCAGTCAGCAGCGCGTGGAGAGGGCCTTGACGCTTTTTGGAATTCACCTGCGCCAAATTCTCGGATCCAAACGCGTGCTGAAGGAGTACAGACTGAACGATAAAGCGTTCGAGTACTTGTTGAAGGAGATCCGAACCAAGTACCAGCAGTCA
TRN  10010101100011001
NAM  Q9NJG6_LEIEN/46-247
ASQ  LDGARIEgNQAFPIPHMTNTEMVDRYRYEYRDEGGFSDSMGGQYMDPFVRDSLLRDPQSVLRLQEEFDQLMKDRAMSRLIIDMEDkNKLKMNLPVNVARLIQNARTTMGKR.-SQVSNL.NPITVINRVRELQEDLVQLFPSHHkDYHGrfvNaLSRERVERALTLFGIHLRQILGSKRVLKEYKLNDKAFEYLLKEIRTKYQQS
DSQ  CTGGATGGCGCACGCATCGAGggcAACCAGGCCTTCCCGATCCCGCATATGACGAACACAGAGATGGTGGACAGGTACCGCTACGAATACAGGGACGAGGGCGGCTTCTCGGACAGCATGGGCGGCCAATACATGGATCCGTTCGTGCGCGACTCGCTGCTGCGCGATCCGCAGAGCGTGCTGAGGCTGCAAGAGGAGTTCGACCAGCTCATGAAGGACCGCGCGATGTCGCGCCTCATCATCGACATGGAGGACaagAACAAGCTCAAGATGAACCTGCCCGTGAACGTCGCGCGTCTCATCCAGAACGCGCGCACGACGATGGGTAAGCGC...---AGTCAGGTGTCGAACTTA...AACCCGATCACTGTGATCAACCGCGTGCGGGAGCTGCAGGAGGACCTCGTACAGCTCTTTCCCTCACACCACaagGACTACCACGGCcgcttcgtgAACgcgCTCAGCCGGGAGCGCGTGGAGCGGGCGCTGACGCTCTTCGGCATCCACCTGCGCCAGATTCTCGGCTCCAAGCGGGTGCTGAAGGAGTACAAGCTGAACGACAAGGCGTTCGAGTACTTGCTGAAGGAAATCCGCACCAAATACCAGCAGTCC
TRN  10010101100011000
NAM  Q9BJ59_LEPSE/851-1052
ASQ  LDGARIEgNQAFPIPHMANNEMIDKYRYEYNEEGSFSENMGGSYMDPFVRDSLLRDPQSVSKLQEEFDQLVKDRDMSRLIIDMEEkNKLKMNLPVNVARLIQNATTTMGQA.-HQVSNL.NPITVIQRVRDCRKTLVQLFPSYHkDYSGrflNvLSQQRVKRALTLFDIHLRQILGSKRVLKEYKLNDKAFEYLLKEIRTKYQQS
DSQ  CTTGATGGGGCCCGCATTGAGggcAATCAGGCGTTCCCAATTCCGCACATGGCGAACAACGAGATGATCGACAAGTACCGCTACGAGTACAATGAAGAGGGCAGCTTCTCTGAGAATATGGGAGGCAGCTACATGGATCCCTTCGTGCGGGACTCGCTACTGCGTGATCCGCAGAGTGTGTCGAAGCTGCAGGAGGAGTTCGACCAGCTCGTCAAGGACCGTGATATGTCCCGCCTCATCATCGACATGGAGGAGaaaAACAAGCTCAAGATGAACCTGCCCGTGAACGTGGCCCGCCTTATTCAGAACGCTACCACGACGATGGGCCAAGCG...---CACCAGGTTTCAAACCTG...AACCCCATCACCGTCATCCAACGCGTGCGGGACTGCAGGAAGACTCTGGTGCAGCTCTTCCCCTCCTACCACaagGACTACAGCGGCcgcttcttgAATgtgCTTAGCCAGCAGCGCGTCAAGCGCGCGCTGACGCTCTTTGACATCCACCTGCGCCAGATTCTCGGCTCGAAGCGAGTGCTGAAGGAGTACAAGCTGAACGACAAGGCCTTTGAGTACTTGTTGAAAGAAATACGTACCAAGTACCAGCAGTCG
TRN  10010101100011001
NAM  Q26794_9TRYP/875-1076
ASQ  LDGARIEgGQLFPLPFRDDKEMEDTYKYEYDVDGTFSGKVGGNYMDPHVRKMLRADPQNVRKLQEEYEQLTADREWSRKMLDLEDrDKLKLNLPVNPGRLIQNARSTMGKR.-SQVSNL.SPITIIDHVRKLQEDLMKLFPSYHrGGDGyirNtLSRERIESALTLFNVHLRQLLASKRVLKEYKLNDRAFEYLLKEIRTKYHQS
DSQ  CTTGACGGGGCCCGTATAGAGggtGGGCAGCTGTTCCCTCTTCCCTTTCGGGACGATAAGGAGATGGAAGACACGTACAAATATGAGTACGACGTGGATGGCACCTTCAGTGGGAAGGTTGGTGGTAACTATATGGATCCCCACGTTAGGAAGATGCTACGCGCTGATCCCCAAAATGTTCGGAAACTTCAGGAAGAATATGAACAGCTTACGGCGGACCGCGAGTGGTCACGCAAAATGCTTGACCTCGAGGATcgtGATAAACTGAAGCTTAACCTCCCTGTTAATCCAGGTCGACTTATCCAAAACGCGCGCAGTACTATGGGCAAACGT...---AGTCAAGTGTCCAACCTG...AGCCCCATCACTATTATCGACCACGTGCGGAAGCTTCAAGAAGATCTCATGAAACTCTTTCCATCTTACCACcggGGAGGGGATGGAtacatcaggAATacgTTGAGTCGTGAACGCATTGAAAGTGCGCTTACTCTCTTCAACGTTCATTTGAGGCAGCTACTTGCGTCAAAAAGGGTGCTGAAGGAATATAAACTTAACGATAGGGCTTTTGAGTATCTTCTCAAGGAAATTAGAACCAAGTACCACCAGTCA
TRN  10010101100011001
NAM  Q26791_9TRYP/875-1076
ASQ  LDGARIEgGQLFPLPFRDDKEMEDTYKYEYDVDGTFSGKVGGNYMDPHVRKMLRADPQNVRKLQEEYEQLTADREWSRKMLDLEDrDKLKLNLPVNPGRLIQNARSTMGKR.-SQVSNL.SPITIIDHVRKLQEDLMKLFPSYHrGGDGyirNtLSRERIESALTLFNVHLRQLLASKRVLKEYKLNDRAFEYLLKEIRTKYHQS
DSQ  CTTGACGGGGCCCGTATAGAGggtGGGCAGCTGTTCCCTCTTCCCTTTCGGGACGATAAGGAGATGGAAGACACGTACAAATATGAGTACGACGTGGATGGCACCTTCAGTGGGAAGGTTGGTGGTAACTATATGGATCCCCACGTTAGGAAGATGCTACGCGCTGATCCCCAAAATGTTCGGAAACTTCAGGAAGAATATGAACAGCTTACGGCGGACCGCGAGTGGTCACGCAAAATGCTTGACCTCGAGGATcgtGATAAACTGAAGCTTAACCTCCCTGTTAATCCAGGTCGACTTATCCAAAACGCGCGCAGTACTATGGGCAAACGT...---AGTCAAGTGTCCAACCTG...AGCCCCATCACTATTATCGACCACGTGCGGAAGCTTCAAGAAGATCTCATGAAACTCTTTCCATCTTACCACcggGGAGGGGATGGAtacatcaggAATacgTTGAGTCGTGAACGCATTGAAAGTGCGCTTACTCTCTTCAACGTTCATTTGAGGCAGCTACTTGCGTCAAAAAGGGTGCTGAAGGAATATAAACTTAACGATAGGGCTTTTGAGTATCTTCTCAAGGAAATTAGAACCAAGTACCACCAGTCA
TRN  10010101100011001
NAM  RPB2_TRYBB/876-1077
ASQ  LDGARIEgGQLFPLPFRDDKEMEDTYKYEYDVDGTFSGKVGGNYMDPHVRKMLRADPQNVRKLQEEYEQLTADREWSRKMLDLEDrDKLKLNLPVNPGRLIQNARSTMGKR.-SQVSNL.SPITIIDHVRKLQEDLMKLFPSYHrGGDGyirNtLSRERIESALTLFNVHLRQLLASKRVLKEYKLNDRAFEYLLKEIRTKYHQS
DSQ  CTTGACGGGGCCCGTATAGAGggtGGGCAGCTGTTCCCTCTTCCCTTTCGGGACGATAAGGAGATGGAAGACACGTACAAATATGAGTACGACGTGGATGGCACCTTCAGTGGGAAGGTTGGTGGTAACTATATGGATCCCCACGTTAGGAAGATGCTACGCGCTGATCCCCAAAATGTTCGGAAACTTCAGGAAGAATATGAACAGCTTACGGCGGACCGCGAGTGGTCACGCAAAATGCTTGACCTCGAGGATcgtGATAAACTGAAGCTTAACCTCCCTGTTAATCCAGGTCGACTTATCCAAAACGCGCGCAGTACTATGGGCAAACGT...---AGTCAAGTGTCCAACCTG...AGCCCCATCACTATTATCGACCACGTGCGGAAGCTTCAAGAAGATCTCATGAAACTCTTTCCATCTTACCACcggGGAGGGGATGGAtacatcaggAATacgTTGAGTCGTGAACGCATTGAAAGTGCGCTTACTCTCTTCAACGTTCATTTGAGGCAGCTACTTGCGTCAAAAAGGGTCCTGAAGGAATATAAACTTAACGATAGGGCTTTTGAGTATCTTCTCAAGGAAATTAGAACCAAGTACCACCAGTCA
TRN  10010101100011001
NAM  RPB1_TRYBB/876-1077
ASQ  LDGARIEgGQLFPLPFRDDKEMEDTYKYEYDVDGTFSGKVGGNYMDPHVRKMLRADPQNVRKLQEEYEQLTADREWSRKMLDLEDrDKLKLNLPVNPGRLIQNARSTMGKR.-SQVSNL.SPITIIDHVRKLQEDLMKLFPSYHrGGDGyirNtLSRERIESALTLFNVHLRQLLASKRVLKEYKLNDRAFEYLLKEIRTKYHQS
DSQ  CTTGACGGGGCCCGTATAGAGggtGGGCAGCTGTTCCCTCTTCCCTTTCGGGACGATAAGGAGATGGAAGACACGTACAAATATGAGTACGACGTGGATGGCACCTTCAGTGGGAAGGTTGGTGGTAACTATATGGATCCCCACGTTAGGAAGATGCTACGCGCTGATCCCCAAAATGTTCGGAAACTTCAGGAAGAATATGAACAGCTTACGGCGGACCGCGAGTGGTCACGCAAAATGCTTGACCTCGAGGATcgtGATAAACTGAAGCTTAACCTCCCTGTTAATCCAGGTCGACTTATCCAAAACGCGCGCAGTACTATGGGCAAACGT...---AGTCAAGTGTCCAACCTG...AGCCCCATCACTATTATCGACCACGTGCGGAAGCTTCAAGAAGATCTCATGAAACTCTTTCCATCTTACCACcggGGAGGGGATGGAtacatcaggAATacgTTGAGTCGTGAACGCATTGAAAGTGCGCTTACTCTCTTCAACGTTCATTTGAGGCAGCTACTTGCGTCAAAAAGGGTGCTGAAGGAATATAAACTTAACGATAGGGCTTTTGAGTATCTTCTCAAGGAAATTAGAACCAAGTACCACCAGTCA
TRN  10010101100011001
NAM  O77165_9EUKA/801-995
ASQ  IDGTAHE.NQDIPSLNADDAKMRKLYDWNTAD----WDQYRPD-FAPETLDEIRRDARVAEVVEREFAQLMADRATVRAIKHATGaRDDNVFLPVHVGRIIAKAKQHYHIS.ETTRSDL.SPADIYTTLDLLITRELNITGAAYaEGRR..aDpLGEEQRSTALTMFAIMLRAQLASKVMILKHHITLDCWGYIIGEVREKFGRA
DSQ  ATTGACGGCACGGCGCATGAG...AACCAGGACATACCGTCCCTCAACGCTGATGACGCCAAGATGCGCAAGCTCTACGACTGGAACACCGCTGAC------------TGGGACCAGTACCGCCCGGAC---TTCGCGCCAGAGACACTGGACGAGATACGGCGCGACGCCCGCGTGGCGGAGGTGGTGGAGCGCGAGTTTGCCCAGTTGATGGCTGACCGCGCTACCGTACGCGCGATCAAGCATGCGACGGGGgccAGGGACGATAACGTGTTCCTGCCTGTGCATGTGGGGCGGATCATCGCCAAGGCCAAGCAGCACTACCACATCTCT...GAGACCACACGCAGCGACCTC...AGCCCCGCAGACATATACACCACGCTGGACCTGCTTATCACGCGTGAGCTCAACATCACTGGCGCGGCGTATgcgGAGGGGCGGCGG......gcaGACcccCTAGGCGAGGAGCAGCGCAGTACCGCCCTCACCATGTTTGCTATCATGCTGAGGGCCCAGCTGGCCTCCAAGGTGATGATACTCAAGCACCACATCACACTGGACTGCTGGGGGTACATCATTGGCGAGGTCAGGGAGAAGTTCGGGCGGGCG
TRN  10010101100011011
//