EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04970 - NC)
FAM  PF04970
PID  NC
DES  NC domain
IPR  IPR007053
ANO  9
ALN  84
AID  0.290534
APH  (TIG3_HUMAN/52-133:0.26123,(HRLP5_MOUSE/163-244:0.39980,((HRSL1_MOUSE/58-139:0.21852,(LRAT_HUMAN/100-181:0.86231,Q9FFE7_ARATH/102-175:0.97405):0.55433):0.21865,(HRSL3_HUMAN/52-133:0.19616,HRSL2_HUMAN/52-133:0.11146):0.25750):0.15463):0.09657,(POLG_EC22H/812-885:1.49314,Q9YLS4_9PICO/803-883:1.56828):0.83981);
ATP  (TIG3_HUMAN/52-133,(HRLP5_MOUSE/163-244,((HRSL1_MOUSE/58-139,(LRAT_HUMAN/100-181,Q9FFE7_ARATH/102-175)),(HRSL3_HUMAN/52-133,HRSL2_HUMAN/52-133))),(POLG_EC22H/812-885,Q9YLS4_9PICO/803-883));
ATL  8.20644
DNO  9
DLN  252
DID  0.422714
DPH  ((POLG_EC22H/812-885:1.31854,(HRSL1_MOUSE/58-139:0.17676,(Q9YLS4_9PICO/803-883:0.86188,Q9FFE7_ARATH/102-175:0.59964):0.40483):0.00000):0.25648,((HRSL3_HUMAN/52-133:0.10612,HRSL2_HUMAN/52-133:0.12159):0.08305,LRAT_HUMAN/100-181:0.81926):0.08586,(HRLP5_MOUSE/163-244:0.30285,TIG3_HUMAN/52-133:0.25882):0.13535);
DTP  ((POLG_EC22H/812-885,(HRSL1_MOUSE/58-139,(Q9YLS4_9PICO/803-883,Q9FFE7_ARATH/102-175))),((HRSL3_HUMAN/52-133,HRSL2_HUMAN/52-133),LRAT_HUMAN/100-181),(HRLP5_MOUSE/163-244,TIG3_HUMAN/52-133));
DTL  5.53103
RID  0.290534
RPH  (TIG3_HUMAN/52-133:0.26123,(HRLP5_MOUSE/163-244:0.39980,((HRSL1_MOUSE/58-139:0.21852,(LRAT_HUMAN/100-181:0.86231,Q9FFE7_ARATH/102-175:0.97405):0.55433):0.21865,(HRSL3_HUMAN/52-133:0.19616,HRSL2_HUMAN/52-133:0.11146):0.25750):0.15463):0.09657,(POLG_EC22H/812-885:1.49314,Q9YLS4_9PICO/803-883:1.56828):0.83981);
RTP  (TIG3_HUMAN/52-133,(HRLP5_MOUSE/163-244,((HRSL1_MOUSE/58-139,(LRAT_HUMAN/100-181,Q9FFE7_ARATH/102-175)),(HRSL3_HUMAN/52-133,HRSL2_HUMAN/52-133))),(POLG_EC22H/812-885,Q9YLS4_9PICO/803-883));
RTL  8.20644
LNK  HRLP5_MOUSE/163-244:Q9CPX5:AK006527
LNK  HRSL1_MOUSE/58-139:Q9QZU4:AF163095
LNK  HRSL2_HUMAN/52-133:Q9NWW9:AK000563
LNK  HRSL3_HUMAN/52-133:P53816:AB030814
LNK  LRAT_HUMAN/100-181:O95237:AF071510
LNK  POLG_EC22H/812-885:Q66578:L02971
LNK  Q9FFE7_ARATH/102-175:Q9FFE7:AB005242
LNK  Q9YLS4_9PICO/803-883:Q9YLS4:AJ225173
LNK  TIG3_HUMAN/52-133:Q9UL19:AF092922
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9FFE7_ARATH/102-175
ASQ  HLFEYSASPSIFLAKR-GGTCTI-------ASSDP--CDEVISRAKFLLLQNGFGEYDLLDNNCEDFAIYCKTGLFVLSVATKF
DSQ  CATCTCTTCGAATACAGTGCCTCTCCGTCTATCTTTCTAGCCAAACGA---GGTGGTACATGCACGATA---------------------GCATCTTCAGATCCT------TGTGATGAAGTCATTTCTCGTGCTAAATTTCTCCTTTTGCAAAATGGATTTGGTGAGTACGATCTTTTAGACAACAATTGTGAAGATTTTGCGATTTATTGCAAAACTGGTTTGTTTGTGTTGTCGGTTGCTACCAAGTTT
TRN  10010101110011000
NAM  LRAT_HUMAN/100-181
ASQ  GVIVKVASIRVDTVEDFAYGANILVNHLDESLQKKALLNEEVARRAEKLLG--FTPYSLLWNNCEHFVTYCRYGTPISPQSDKF
DSQ  GGCGTTATTGTCAAAGTGGCCAGCATCCGCGTGGACACAGTGGAGGACTTCGCCTACGGAGCTAACATCCTGGTCAATCACCTGGACGAGTCCCTCCAGAAAAAGGCACTGCTCAACGAGGAGGTGGCGCGGAGGGCTGAAAAGCTGCTGGGC------TTTACCCCCTACAGCCTGCTGTGGAACAACTGCGAGCACTTCGTGACCTACTGCAGATATGGCACCCCGATCAGTCCCCAGTCCGACAAGTTT
TRN  10010101100011011
NAM  HRSL2_HUMAN/52-133
ASQ  SALTNKAIVKKELLSVVAGGDNYRVNNKHDDRYTPLPSNKIVKRAEELVGQ--ELPYSLTSDNCEHFVNHLRYGVSRSDQVTGA
DSQ  TCTGCCCTGACCAACAAAGCCATAGTGAAGAAGGAACTGCTGTCTGTGGTGGCTGGGGGAGACAACTACAGGGTCAATAACAAGCACGATGACAGATACACACCACTGCCTTCCAACAAAATCGTCAAGCGGGCAGAGGAGTTGGTGGGGCAG------GAGTTGCCTTATTCGCTGACCAGTGACAACTGCGAGCACTTCGTGAACCATCTGCGCTATGGCGTCTCCCGCAGTGACCAGGTCACTGGTGCA
TRN  10010101100011011
NAM  HRSL3_HUMAN/52-133
ASQ  SALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQ--EVLYKLTSENCEHFVNELRYGVARSDQVRDV
DSQ  TCCGCCCTGACTGACAAGGCCATCGTGAAGAAGGAATTGCTGTATGATGTGGCCGGGAGTGACAAGTACCAGGTCAACAACAAACATGATGACAAGTACTCGCCGCTGCCCTGCAGCAAAATCATCCAGCGGGCGGAGGAGCTGGTGGGGCAG------GAGGTGCTCTACAAGCTGACCAGTGAGAACTGCGAGCACTTTGTGAATGAGCTGCGCTATGGAGTCGCCCGCAGTGACCAGGTCAGAGATGTC
TRN  10010101100011011
NAM  TIG3_HUMAN/52-133
ASQ  SVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQ--KMKYSIVSRNCEHFVTQLRYGKSRCKQVEKA
DSQ  TCAGTCCTGAGCAACAGTGCAGAGGTGAAACGGGAGCGCCTGGAAGATGTGGTGGGAGGCTGTTGCTATCGGGTCAACAACAGCTTGGACCATGAGTACCAACCACGGCCCGTGGAGGTGATCATCAGTTCTGCGAAGGAGATGGTTGGTCAG------AAGATGAAGTACAGTATTGTGAGCAGGAACTGTGAGCACTTTGTCACCCAGCTGAGATATGGCAAGTCCCGCTGTAAACAGGTGGAAAAGGCC
TRN  10010101100011001
NAM  HRSL1_MOUSE/58-139
ASQ  SVFSTKALVKMQLLKDVVGNDTYRINNKYDTTYPPLPVEEVIQRSEFPIGQ--EVAYDLLVNNCEHFVTLLRYGEGVSEQANRA
DSQ  TCCGTGTTCAGCACAAAGGCCTTGGTGAAAATGCAGCTTTTGAAGGATGTTGTGGGAAATGACACATACAGAATAAATAACAAGTACGACACAACATACCCTCCTCTTCCTGTGGAGGAGGTGATACAACGGTCAGAGTTCCCTATTGGGCAG------GAAGTAGCCTATGACTTGCTGGTCAACAACTGTGAGCATTTTGTAACCTTGCTGCGCTATGGAGAAGGAGTGTCAGAGCAGGCCAACCGAGCA
TRN  10010101100011001
NAM  HRLP5_MOUSE/163-244
ASQ  SIFSNRAVVKYSRLEDVLHGCSWKINNKLDGTYLPLPVDKIMQRTKNMINK--IVQYSLIEGNCEHFVNDLRYGVPRSQQVEHA
DSQ  TCTATCTTCAGCAACCGAGCTGTGGTGAAGTACAGCCGGCTGGAGGATGTGCTGCACGGTTGCTCCTGGAAGATCAACAACAAGCTGGATGGCACATACCTGCCGCTGCCGGTGGACAAGATCATGCAGCGCACAAAAAACATGATAAACAAG------ATAGTTCAGTACAGCCTAATTGAGGGGAACTGTGAGCACTTTGTCAATGACCTCAGATATGGTGTGCCCAGGAGCCAGCAGGTGGAGCACGCC
TRN  10010101100011011
NAM  Q9YLS4_9PICO/803-883
ASQ  VDPEGNATNWFMKRKATVKKSKN-LDKWCFALSPRIDRTLICETANLMVGR--EVEYDIFVKNCETYARGIASGDYGTKEGEKW
DSQ  GTGGATCCAGAAGGCAATGCCACTAACTGGTTTATGAAGCGAAAAGCTACAGTCAAGAAGAGCAAAAAT---CTGGACAAATGGTGCTTTGCCTTGTCTCCACGCATAGATAGGACACTCATATGTGAGACAGCCAACCTGATGGTGGGACGC------GAGGTTGAGTATGATATCTTTGTGAAGAATTGTGAGACATATGCTCGGGGTATTGCATCAGGCGACTATGGGACAAAAGAAGGAGAAAAATGG
TRN  10010101100011001
NAM  POLG_EC22H/812-885
ASQ  DDIFKTALTGKAKFTKTKLTSDWVIEEECELDYFR------IKYLESAVDS--EHIFS-VDKNCETIAKDI-FGTHTLSQHQAI
DSQ  GATGACATTTTCAAGACAGCATTGACAGGAAAAGCCAAATTTACTAAAACTAAGTTGACTTCAGATTGGGTTATTGAAGAAGAGTGTGAATTAGACTACTTTAGA------------------ATCAAATATCTTGAATCAGCTGTGGATTCA------GAGCACATTTTTTCA---GTAGACAAAAACTGTGAAACCATTGCCAAGGATATT---TTTGGAACCCATACACTAAGCCAACATCAAGCAATA
TRN  10010101110011000
//