EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04968 - CHORD)
FAM  PF04968
PID  CHORD
DES  CHORD
IPR  IPR007051
ANO  14
ALN  66
AID  0.433005
APH  (((((((ITBP2_MOUSE/1-65:0.15019,Q9D1P4_MOUSE/1-65:0.25091):0.03594,(Q9U4A3_DROME/1-64:0.14310,Q9U4A6_CAEEL/5-69:0.40208):0.19087):0.24297,((Q9U4A7_TOXGO/125-189:0.34329,Q9N8L2_9TRYP/239-304:0.59304):0.23395,(Q9SE33_ARATH/155-219:0.53942,Q9N8L2_9TRYP/108-173:0.45541):0.07150):0.28396):0.08653,(Q9SE33_ARATH/8-72:0.51721,Q9U4A7_TOXGO/1-65:0.57768):0.16066):0.34174,Q9VCC0_DROME/136-200:0.22769):0.13085,Q9U4A6_CAEEL/148-211:0.36272):0.04113,Q9D1P4_MOUSE/153-217:0.27860,ITBP2_MOUSE/146-210:0.53137);
ATP  (((((((ITBP2_MOUSE/1-65,Q9D1P4_MOUSE/1-65),(Q9U4A3_DROME/1-64,Q9U4A6_CAEEL/5-69)),((Q9U4A7_TOXGO/125-189,Q9N8L2_9TRYP/239-304),(Q9SE33_ARATH/155-219,Q9N8L2_9TRYP/108-173))),(Q9SE33_ARATH/8-72,Q9U4A7_TOXGO/1-65)),Q9VCC0_DROME/136-200),Q9U4A6_CAEEL/148-211),Q9D1P4_MOUSE/153-217,ITBP2_MOUSE/146-210);
ATL  7.27319
DNO  14
DLN  198
DID  0.500006
DPH  ((((Q9SE33_ARATH/8-72:0.33297,((((ITBP2_MOUSE/1-65:0.17948,Q9U4A3_DROME/1-64:0.25730):0.09488,Q9D1P4_MOUSE/1-65:0.24515):0.06490,Q9U4A6_CAEEL/5-69:0.34258):0.14249,(((Q9D1P4_MOUSE/153-217:0.19722,(ITBP2_MOUSE/146-210:0.38218,Q9U4A6_CAEEL/148-211:0.31150):0.09982):0.16328,Q9VCC0_DROME/136-200:0.33942):0.10325,Q9U4A7_TOXGO/1-65:0.42735):0.11582):0.08321):0.11344,Q9SE33_ARATH/155-219:0.39392):0.17706,Q9U4A7_TOXGO/125-189:0.26008):0.10880,Q9N8L2_9TRYP/239-304:0.39966,Q9N8L2_9TRYP/108-173:0.42664);
DTP  ((((Q9SE33_ARATH/8-72,((((ITBP2_MOUSE/1-65,Q9U4A3_DROME/1-64),Q9D1P4_MOUSE/1-65),Q9U4A6_CAEEL/5-69),(((Q9D1P4_MOUSE/153-217,(ITBP2_MOUSE/146-210,Q9U4A6_CAEEL/148-211)),Q9VCC0_DROME/136-200),Q9U4A7_TOXGO/1-65))),Q9SE33_ARATH/155-219),Q9U4A7_TOXGO/125-189),Q9N8L2_9TRYP/239-304,Q9N8L2_9TRYP/108-173);
DTL  5.7624
RID  0.433005
RPH  (((((((ITBP2_MOUSE/1-65:0.15019,Q9D1P4_MOUSE/1-65:0.25091):0.03594,(Q9U4A3_DROME/1-64:0.14310,Q9U4A6_CAEEL/5-69:0.40208):0.19087):0.24297,((Q9U4A7_TOXGO/125-189:0.34329,Q9N8L2_9TRYP/239-304:0.59304):0.23395,(Q9SE33_ARATH/155-219:0.53942,Q9N8L2_9TRYP/108-173:0.45541):0.07150):0.28396):0.08653,(Q9SE33_ARATH/8-72:0.51721,Q9U4A7_TOXGO/1-65:0.57768):0.16066):0.34174,Q9VCC0_DROME/136-200:0.22769):0.13085,Q9U4A6_CAEEL/148-211:0.36272):0.04113,Q9D1P4_MOUSE/153-217:0.27860,ITBP2_MOUSE/146-210:0.53137);
RTP  (((((((ITBP2_MOUSE/1-65,Q9D1P4_MOUSE/1-65),(Q9U4A3_DROME/1-64,Q9U4A6_CAEEL/5-69)),((Q9U4A7_TOXGO/125-189,Q9N8L2_9TRYP/239-304),(Q9SE33_ARATH/155-219,Q9N8L2_9TRYP/108-173))),(Q9SE33_ARATH/8-72,Q9U4A7_TOXGO/1-65)),Q9VCC0_DROME/136-200),Q9U4A6_CAEEL/148-211),Q9D1P4_MOUSE/153-217,ITBP2_MOUSE/146-210);
RTL  7.27319
LNK  ITBP2_MOUSE/146-210:Q9R000:AF140691
LNK  ITBP2_MOUSE/1-65:Q9R000:AF140691
LNK  Q9D1P4_MOUSE/153-217:Q9D1P4:AK003259
LNK  Q9D1P4_MOUSE/1-65:Q9D1P4:AK003259
LNK  Q9N8L2_9TRYP/108-173:Q9N8L2:AL929605
LNK  Q9N8L2_9TRYP/239-304:Q9N8L2:AL929605
LNK  Q9SE33_ARATH/155-219:Q9SE33:AF192262
LNK  Q9SE33_ARATH/8-72:Q9SE33:AF192262
LNK  Q9U4A3_DROME/1-64:Q9U4A3:AF192465
LNK  Q9U4A6_CAEEL/148-211:Q9U4A6:AF192264
LNK  Q9U4A6_CAEEL/5-69:Q9U4A6:AF192264
LNK  Q9U4A7_TOXGO/125-189:Q9U4A7:AF192263
LNK  Q9U4A7_TOXGO/1-65:Q9U4A7:AF192263
LNK  Q9VCC0_DROME/136-200:Q9VCC0:AE003746
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9U4A7_TOXGO/125-189
ASQ  GNYKCSNKGCNKEYSPNDNSPTACKFHPGQPVFRDCMKSWTCCQ-AKSYDWDEFMKIEPCQTGPHV
DSQ  GGGAATTACAAGTGCAGCAACAAGGGCTGCAACAAAGAATATTCGCCGAACGACAATTCACCAACGGCATGCAAATTTCACCCAGGACAACCAGTTTTCCGGGATTGCATGAAGTCGTGGACGTGCTGTCAA---GCGAAAAGTTACGACTGGGATGAGTTCATGAAAATCGAACCCTGTCAGACAGGACCGCACGTC
TRN  11111101111011001
NAM  Q9N8L2_9TRYP/239-304
ASQ  GKAKCRNFGCQQEFIVADNHPTACRYHSEGPVFWDTYRYWKCCPDKKCFDFDDFVKVPGCSVGPHL
DSQ  GGAAAGGCAAAGTGCCGTAACTTCGGCTGCCAGCAAGAGTTTATTGTGGCAGATAACCACCCAACGGCATGCCGTTACCACAGTGAGGGCCCCGTGTTTTGGGACACATATAGGTATTGGAAGTGTTGCCCAGACAAAAAGTGTTTCGACTTTGATGACTTCGTAAAGGTTCCCGGATGCAGCGTAGGGCCGCACCTG
TRN  10010101100011011
NAM  Q9N8L2_9TRYP/108-173
ASQ  GSIICTNYGCGQYFLPGENNDTACKHHKEPPVFHDIEKYWRCCTSRRARDWEEFKAIPACCTGPHS
DSQ  GGTTCCATCATATGTACCAACTATGGCTGCGGCCAGTATTTTCTTCCAGGGGAAAATAACGACACAGCCTGCAAACACCACAAGGAGCCACCTGTCTTTCACGACATTGAGAAGTACTGGCGCTGCTGCACATCACGGCGGGCGCGCGATTGGGAAGAGTTTAAGGCGATTCCGGCCTGTTGCACGGGGCCACATAGC
TRN  10010101110011001
NAM  Q9SE33_ARATH/155-219
ASQ  QPQVCKNKGCGQTFKERDNHETACSHHPGPAVFHDRLRGWKCCD-VHVKEFDEFMEIPPCTKGWHS
DSQ  CAACCGCAAGTCTGCAAAAACAAAGGATGTGGCCAAACATTCAAAGAGAGAGACAATCATGAGACTGCATGTAGCCATCATCCAGGTCCTGCGGTCTTCCACGACAGACTGAGAGGGTGGAAATGTTGCGAT---GTTCACGTGAAGGAGTTCGACGAGTTCATGGAAATACCTCCTTGCACTAAAGGATGGCATAGC
TRN  10010101100011011
NAM  Q9U4A7_TOXGO/1-65
ASQ  MQKKCTRPGCGKSYKETENEEGSCVYHAAMPIFHDGVKRWPCCD-AEAWDWTDFMAIKGCSFGKHT
DSQ  ATGCAGAAAAAGTGCACCCGTCCAGGATGTGGAAAGAGCTACAAAGAAACAGAGAATGAGGAGGGAAGCTGCGTTTATCATGCGGCAATGCCCATTTTTCACGACGGCGTCAAAAGGTGGCCATGCTGTGAT---GCAGAGGCCTGGGACTGGACAGACTTCATGGCCATTAAAGGCTGTTCCTTCGGCAAGCATACA
TRN  10110101110011011
NAM  Q9U4A6_CAEEL/148-211
ASQ  IGAPCRNNGCSTEFDGSKNKEN-CQHHPGAAIFHEGMKYWSCCN-KKTSNFGAFLEQVGCTSGEHK
DSQ  ATTGGCGCCCCATGTCGAAACAATGGATGTTCTACTGAATTCGATGGATCGAAAAACAAGGAAAAC---TGTCAGCATCACCCTGGAGCTGCCATTTTCCACGAAGGAATGAAGTATTGGTCGTGTTGTAAC---AAGAAAACTTCTAATTTTGGAGCTTTCCTTGAGCAAGTGGGCTGCACTTCAGGCGAACATAAG
TRN  11011101111011001
NAM  Q9VCC0_DROME/136-200
ASQ  VGTTCKNNGCTYSFTGNSSDFGECTYHPGVPIFHEGMKFWSCCQ-KRTSDFSQFMAQKGCTYGEHK
DSQ  GTGGGAACCACTTGCAAGAATAACGGCTGCACCTACTCCTTTACGGGTAACAGCAGCGACTTTGGCGAGTGCACCTACCATCCGGGCGTGCCAATCTTTCACGAGGGCATGAAATTCTGGTCCTGCTGCCAG---AAACGAACCTCGGACTTTTCCCAGTTTATGGCGCAAAAGGGCTGTACCTACGGTGAGCACAAA
TRN  11111101111011011
NAM  Q9D1P4_MOUSE/153-217
ASQ  IGTSCKNGGCSKTYQGLQSLEEVCVYHSGVPIFHEGMKYWSCCR-RKTSDFNTFLAQEGCTRGKHV
DSQ  ATTGGGACTTCCTGTAAAAATGGAGGGTGTTCAAAGACATACCAGGGTCTACAGAGTCTAGAAGAAGTCTGTGTATATCATTCTGGAGTACCTATTTTCCACGAGGGGATGAAATATTGGAGCTGTTGTAGA---AGAAAAACTTCAGATTTTAATACATTCTTAGCCCAAGAGGGCTGTACAAGAGGGAAGCATGTA
TRN  10010101110011000
NAM  ITBP2_MOUSE/146-210
ASQ  TGSSCQNPGCDAVYQGPESDATPCTYHPGAPRFHEGMKSWSCCG-IQTLDFGAFLAQPGCRVGRHD
DSQ  ACTGGTTCCAGCTGCCAGAACCCAGGATGTGATGCTGTTTACCAAGGTCCTGAGAGTGATGCTACTCCGTGTACCTATCACCCAGGGGCACCTCGGTTTCATGAGGGGATGAAGTCTTGGAGCTGTTGTGGT---ATCCAGACTCTGGATTTTGGGGCATTCCTGGCACAGCCAGGATGTAGAGTTGGTAGACATGAT
TRN  10010101100011011
NAM  Q9U4A6_CAEEL/5-69
ASQ  SKLQCYHKGCGLLFDPKENDNEACTYHPGGPYFHDAYKIWTCCD-KKSTDFGTWMNYKGCTRGKHS
DSQ  AGTAAACTGCAGTGCTATCATAAAGGATGCGGTCTCCTTTTCGATCCCAAGGAGAATGACAACGAAGCTTGTACATATCACCCTGGGGGTCCGTATTTCCATGATGCATACAAGATTTGGACATGTTGTGAT---AAGAAAAGTACTGATTTCGGTACATGGATGAATTATAAAGGATGTACGCGTGGAAAACACAGC
TRN  11011101101011011
NAM  Q9U4A3_DROME/1-64
ASQ  -MEQCYNRGCGQLFDPQTNNDESCRHHPGEPFFHDAYKGWSCCN-KKSVDFTEFLNIKGCTLAKHS
DSQ  ---ATGGAACAATGCTATAACAGAGGCTGTGGCCAACTCTTCGATCCGCAGACCAACAATGATGAATCTTGTCGGCACCATCCGGGTGAACCTTTCTTCCACGACGCCTATAAGGGTTGGTCCTGCTGCAAC---AAGAAGTCGGTCGACTTCACCGAGTTCCTCAACATCAAGGGCTGCACCTTGGCAAAGCACTCG
TRN  10010101110011011
NAM  Q9D1P4_MOUSE/1-65
ASQ  MALLCYNRGCGQRFDPEANSDDACTYHPGVPVFHDALKGWSCCK-RRTTDFSDFLSIVGCTKGRHN
DSQ  ATGGCGCTCTTGTGTTACAACCGCGGCTGTGGCCAGCGTTTCGACCCAGAGGCCAACTCGGACGATGCTTGCACATACCACCCAGGTGTTCCTGTCTTTCATGATGCCCTAAAGGGTTGGTCTTGCTGTAAA---AGAAGGACAACTGATTTCTCTGACTTCTTAAGCATTGTAGGCTGTACAAAAGGTAGGCATAAT
TRN  10010101110011010
NAM  ITBP2_MOUSE/1-65
ASQ  MSLLCYNKGCGQHFDPNTNLPDSCRYHPGVPIFHDALKGWSCCR-KRTVDFSEFLNIKGCTVGLHC
DSQ  ATGTCTCTGCTCTGCTATAACAAAGGCTGTGGGCAACACTTTGACCCCAATACCAATCTCCCTGATTCCTGTCGCTATCACCCTGGGGTGCCAATCTTTCATGATGCACTTAAGGGTTGGTCCTGCTGCCGA---AAGCGAACTGTAGATTTCTCTGAGTTCTTAAACATCAAGGGCTGTACTGTGGGACTACACTGT
TRN  11011101101011010
NAM  Q9SE33_ARATH/8-72
ASQ  KKLQCQRIGCNAMFTDDDNPQGSCQFHASGPFFHDGMKEWSCCK-QRSHDFSLFLEIPGCKTGKHT
DSQ  AAGAAGCTTCAGTGCCAACGTATTGGCTGCAACGCCATGTTCACCGATGACGACAATCCTCAAGGTTCTTGTCAATTTCATGCTTCCGGACCATTTTTTCACGACGGAATGAAAGAGTGGAGCTGCTGCAAG---CAAAGAAGTCATGATTTCAGTTTGTTCTTGGAAATTCCAGGATGTAAAACAGGTAAACACACA
TRN  10010101110011011
//