EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04959 - ARS2)
FAM  PF04959
PID  ARS2
DES  Arsenite-resistance protein 2
IPR  IPR007042
ANO  3
ALN  227
AID  0.587885
APH  (ARS2_CRIGR/66-290:0.18554,ARS2_HUMAN/636-857:0.15299,ARS2_DROME/736-936:0.71286);
ATP  (ARS2_CRIGR/66-290,ARS2_HUMAN/636-857,ARS2_DROME/736-936);
ATL  1.05139
DNO  2
DLN  681
DID  0.540816
DPH  (ARS2_HUMAN/636-857:0.71450,ARS2_DROME/736-936:0.00000);
DTP  (ARS2_HUMAN/636-857,ARS2_DROME/736-936);
DTL  0.7145
RID  0.518919
RPH  (ARS2_HUMAN/636-857:0.44632,ARS2_DROME/736-936:0.35976);
RTP  (ARS2_HUMAN/636-857,ARS2_DROME/736-936);
RTL  0.80608
LNK  ARS2_CRIGR/66-290:Q60436:
LNK  ARS2_DROME/736-936:Q9V9K7:AE003784
LNK  ARS2_HUMAN/636-857:Q9BXP5:AF312032
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  ARS2_CRIGR/66-290
ASQ  MPNRCGIIHVRGPMPPNRISHGEVLEWQKTFEEKLTPLLSVRESFLRKRPRRWVVK-T-EQEVEKFVTSNTQELGKDKWLCPLSGKKFKGPEFVRKHIFNKHAEKIEEVKKEVAFFNNFLTDAKRPALPEMKPAQPPGPAQILPPGLTPGLPYPHQTPQGLMPYGQPALPIFGLWSWCCPPCRSQQEGLHIPMVRMALGAGTMTLFEAKEDILGNLGTGWFEETRGP
NAM  ARS2_HUMAN/636-857
ASQ  MPNRCGIIHVRGPMPPNRISHGEVLEWQKTFEEKLTPLLSVRESLSEEEAQKMGRK-DPEQEVEKFVTSNTQELGKDKWLCPLSGKKFKGPEFVRKHIFNKHAEKIEEVKKEVAFFNNFLTDAKRPALPEIKPAQPPGPAQILPPGLTPGLPYPHQTPQGLMPYGQPRPPILGYGAGAVRPA-VPTGGPPYPHAPYGAGRGNYDAFRGQG---GYPGKPRNRMVRGD
DSQ  ATGCCCAATCGCTGTGGGATCATCCACGTTCGGGGGCCCATGCCACCCAACCGCATCAGTCACGGGGAAGTGCTGGAGTGGCAGAAGACTTTTGAGGAGAAGCTCACGCCGTTGCTGAGTGTGCGGGAGTCACTCTCAGAGGAAGAGGCCCAGAAGATGGGGCGCAAA---GACCCAGAGCAGGAAGTGGAGAAGTTCGTCACCTCCAACACGCAGGAACTGGGCAAGGATAAGTGGCTGTGTCCTCTCAGTGGCAAGAAATTCAAGGGTCCTGAGTTTGTGCGCAAACATATCTTCAACAAGCATGCAGAGAAAATTGAGGAAGTGAAAAAGGAAGTCGCGTTTTTTAACAACTTCCTCACTGATGCTAAGCGCCCAGCTCTGCCTGAGATCAAGCCAGCCCAGCCACCTGGCCCCGCCCAGATACTCCCCCCAGGTTTGACCCCAGGACTCCCCTACCCACACCAGACTCCCCAGGGCCTGATGCCCTATGGTCAGCCCCGGCCCCCGATCTTGGGCTATGGAGCTGGTGCTGTCCGCCCTGCA---GTCCCCACAGGAGGCCCTCCATACCCCCATGCCCCGTATGGTGCTGGTCGAGGGAACTATGATGCCTTCCGAGGCCAGGGA---------GGTTATCCTGGGAAACCTCGCAACAGGATGGTTCGTGGAGAC
TRN  10010101100011001
NAM  ARS2_DROME/736-936
ASQ  MPNRCGIIHARGP-PPVRVTNNDVQEYIKIYESKLQQFLTKTVPLSDEEIKNLGAKDA-ETEVEKFVQANTQELAKDKWLCPLSGKKFKGPEFIRKHIFNKHEEKVDEVRKEVQYFNNYLRDPKRPQLPE-HPGTSKRPESESARGGGGGYRPPMYPPFSAMPYG------FG-----PPMMGGGRGGRNFPPARRELP------LEHQRRLIG------YHDLDAP
DSQ  ATGCCCAACCGCTGCGGCATTATCCATGCCCGCGGTCCA---CCTCCTGTTCGGGTGACCAACAACGACGTGCAAGAGTATATCAAGATATACGAAAGCAAGTTGCAACAGTTTCTTACTAAGACTGTGCCACTGAGTGACGAAGAGATTAAGAATCTTGGAGCCAAGGACGCC---GAAACGGAGGTGGAAAAGTTTGTGCAAGCGAACACTCAGGAGTTAGCCAAAGACAAATGGTTGTGCCCCCTATCGGGTAAGAAGTTTAAGGGGCCCGAGTTCATCCGCAAGCACATCTTCAACAAGCACGAGGAAAAGGTCGACGAGGTGCGCAAGGAGGTGCAATACTTTAACAACTATCTACGCGATCCTAAGCGTCCGCAACTTCCCGAA---CATCCAGGCACCTCTAAGCGTCCAGAATCGGAATCTGCTCGTGGAGGTGGTGGAGGATACCGACCGCCCATGTATCCACCTTTTTCGGCAATGCCCTATGGT------------------TTTGGT---------------CCACCCATGATGGGTGGTGGCCGTGGAGGACGCAACTTCCCTCCCGCGCGCAGAGAATTGCCT------------------TTGGAACACCAGCGCCGGCTTATCGGT------------------TACCATGATTTGGATGCGCCT
TRN  10010101100011010
//