EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04945 - YHS)
FAM  PF04945
PID  YHS
DES  YHS domain
IPR  IPR007029
ANO  26
ALN  45
AID  0.318021
APH  ((((Q46151_9GAMM/19-62:0.68957,(((((Q9CNI0_PASMU/418-462:0.37415,Q9ZC53_YERPE/411-455:0.29406):0.35582,Q9PM17_CAMJE/410-454:0.45423):0.24583,Q9KLU4_VIBCH/41-84:0.84279):0.20034,(((DMPN_PSESP/412-452:0.34955,O32431_ACISP/420-459:0.23414):0.15444,(Q9ZNP4_COMTE/413-453:0.22741,O84961_9RALS/410-450:0.25997):0.09820):0.46114,(Q97YT0_SULSO/200-240:0.30957,(O87082_XANP2/408-446:0.21180,((O07068_BURCE/409-449:0.08402,((TMOA_PSEME/407-447:0.26118,Q9EZP0_BURCE/408-448:0.33889):0.08042,O87798_PSEST/408-448:0.15929):0.11229):0.18330,Q9RBP2_9NOCA/410-452:0.23613):0.17271):0.33688):0.70870):0.26147):0.17890,(Q9HJ29_THEAC/4-45:0.42180,Q9WYF0_THEMA/6-50:0.41824):0.14861):0.00000):0.14555,((SILP_SALTY/45-88:0.76618,(ATCU_RHILV/83-127:0.38177,Q98C24_RHILO/82-126:0.17156):0.32798):0.19061,(Q98C24_RHILO/36-80:0.05873,ATCU_RHILV/37-81:0.30299):0.36790):0.32892):0.26864,Q9F3R6_9BURK/1-40:0.21569):0.87131,Q9HJ30_THEAC/5-48:0.23085,Q978Z8_THEVO/1-40:0.03351);
ATP  ((((Q46151_9GAMM/19-62,(((((Q9CNI0_PASMU/418-462,Q9ZC53_YERPE/411-455),Q9PM17_CAMJE/410-454),Q9KLU4_VIBCH/41-84),(((DMPN_PSESP/412-452,O32431_ACISP/420-459),(Q9ZNP4_COMTE/413-453,O84961_9RALS/410-450)),(Q97YT0_SULSO/200-240,(O87082_XANP2/408-446,((O07068_BURCE/409-449,((TMOA_PSEME/407-447,Q9EZP0_BURCE/408-448),O87798_PSEST/408-448)),Q9RBP2_9NOCA/410-452))))),(Q9HJ29_THEAC/4-45,Q9WYF0_THEMA/6-50))),((SILP_SALTY/45-88,(ATCU_RHILV/83-127,Q98C24_RHILO/82-126)),(Q98C24_RHILO/36-80,ATCU_RHILV/37-81))),Q9F3R6_9BURK/1-40),Q9HJ30_THEAC/5-48,Q978Z8_THEVO/1-40);
ATL  14.6283
DNO  26
DLN  135
DID  0.439041
DPH  (((((Q46151_9GAMM/19-62:0.48260,((SILP_SALTY/45-88:0.49100,(ATCU_RHILV/83-127:0.30381,Q98C24_RHILO/82-126:0.15411):0.08625):0.10306,(Q98C24_RHILO/36-80:0.20769,ATCU_RHILV/37-81:0.12963):0.25708):0.11631):0.05948,(Q9HJ29_THEAC/4-45:0.30064,Q9WYF0_THEMA/6-50:0.35962):0.10047):0.00000,(((Q9ZNP4_COMTE/413-453:0.11869,((DMPN_PSESP/412-452:0.20943,O32431_ACISP/420-459:0.37013):0.16182,O84961_9RALS/410-450:0.12516):0.05457):0.27198,(Q97YT0_SULSO/200-240:0.53779,(((Q9EZP0_BURCE/408-448:0.15718,(TMOA_PSEME/407-447:0.31200,O87798_PSEST/408-448:0.18037):0.10263):0.06620,O07068_BURCE/409-449:0.26704):0.07491,(O87082_XANP2/408-446:0.19190,Q9RBP2_9NOCA/410-452:0.25417):0.05920):0.18856):0.22127):0.03855,((Q9CNI0_PASMU/418-462:0.22740,Q9ZC53_YERPE/411-455:0.36568):0.19086,(Q9PM17_CAMJE/410-454:0.45060,Q9KLU4_VIBCH/41-84:0.53831):0.14627):0.32072):0.07875):0.11646,Q9F3R6_9BURK/1-40:0.33531):0.41898,Q9HJ30_THEAC/5-48:0.11355,Q978Z8_THEVO/1-40:0.26835);
DTP  (((((Q46151_9GAMM/19-62,((SILP_SALTY/45-88,(ATCU_RHILV/83-127,Q98C24_RHILO/82-126)),(Q98C24_RHILO/36-80,ATCU_RHILV/37-81))),(Q9HJ29_THEAC/4-45,Q9WYF0_THEMA/6-50)),(((Q9ZNP4_COMTE/413-453,((DMPN_PSESP/412-452,O32431_ACISP/420-459),O84961_9RALS/410-450)),(Q97YT0_SULSO/200-240,(((Q9EZP0_BURCE/408-448,(TMOA_PSEME/407-447,O87798_PSEST/408-448)),O07068_BURCE/409-449),(O87082_XANP2/408-446,Q9RBP2_9NOCA/410-452)))),((Q9CNI0_PASMU/418-462,Q9ZC53_YERPE/411-455),(Q9PM17_CAMJE/410-454,Q9KLU4_VIBCH/41-84)))),Q9F3R6_9BURK/1-40),Q9HJ30_THEAC/5-48,Q978Z8_THEVO/1-40);
DTL  10.6288
RID  0.318021
RPH  ((((Q46151_9GAMM/19-62:0.68957,(((((Q9CNI0_PASMU/418-462:0.37415,Q9ZC53_YERPE/411-455:0.29406):0.35582,Q9PM17_CAMJE/410-454:0.45423):0.24583,Q9KLU4_VIBCH/41-84:0.84279):0.20034,(((DMPN_PSESP/412-452:0.34955,O32431_ACISP/420-459:0.23414):0.15444,(Q9ZNP4_COMTE/413-453:0.22741,O84961_9RALS/410-450:0.25997):0.09820):0.46114,(Q97YT0_SULSO/200-240:0.30957,(O87082_XANP2/408-446:0.21180,((O07068_BURCE/409-449:0.08402,((TMOA_PSEME/407-447:0.26118,Q9EZP0_BURCE/408-448:0.33889):0.08042,O87798_PSEST/408-448:0.15929):0.11229):0.18330,Q9RBP2_9NOCA/410-452:0.23613):0.17271):0.33688):0.70870):0.26147):0.17890,(Q9HJ29_THEAC/4-45:0.42180,Q9WYF0_THEMA/6-50:0.41824):0.14861):0.00000):0.14555,((SILP_SALTY/45-88:0.76618,(ATCU_RHILV/83-127:0.38177,Q98C24_RHILO/82-126:0.17156):0.32798):0.19061,(Q98C24_RHILO/36-80:0.05873,ATCU_RHILV/37-81:0.30299):0.36790):0.32892):0.26864,Q9F3R6_9BURK/1-40:0.21569):0.87131,Q9HJ30_THEAC/5-48:0.23085,Q978Z8_THEVO/1-40:0.03351);
RTP  ((((Q46151_9GAMM/19-62,(((((Q9CNI0_PASMU/418-462,Q9ZC53_YERPE/411-455),Q9PM17_CAMJE/410-454),Q9KLU4_VIBCH/41-84),(((DMPN_PSESP/412-452,O32431_ACISP/420-459),(Q9ZNP4_COMTE/413-453,O84961_9RALS/410-450)),(Q97YT0_SULSO/200-240,(O87082_XANP2/408-446,((O07068_BURCE/409-449,((TMOA_PSEME/407-447,Q9EZP0_BURCE/408-448),O87798_PSEST/408-448)),Q9RBP2_9NOCA/410-452))))),(Q9HJ29_THEAC/4-45,Q9WYF0_THEMA/6-50))),((SILP_SALTY/45-88,(ATCU_RHILV/83-127,Q98C24_RHILO/82-126)),(Q98C24_RHILO/36-80,ATCU_RHILV/37-81))),Q9F3R6_9BURK/1-40),Q9HJ30_THEAC/5-48,Q978Z8_THEVO/1-40);
RTL  14.6283
LNK  ATCU_RHILV/37-81:Q9X5V3:AF127795
LNK  ATCU_RHILV/83-127:Q9X5V3:AF127795
LNK  DMPN_PSESP/412-452:P19732:M60276
LNK  O07068_BURCE/409-449:O07068:AF001356
LNK  O32431_ACISP/420-459:O32431:D85083
LNK  O84961_9RALS/410-450:O84961:AF026065
LNK  O87082_XANP2/408-446:O87082:AJ006979
LNK  O87798_PSEST/408-448:O87798:AJ005663
LNK  Q46151_9GAMM/19-62:Q46151:U51165
LNK  Q978Z8_THEVO/1-40:Q978Z8:BA000011
LNK  Q97YT0_SULSO/200-240:Q97YT0:AE006738
LNK  Q98C24_RHILO/36-80:Q98C24:BA000012
LNK  Q98C24_RHILO/82-126:Q98C24:BA000012
LNK  Q9CNI0_PASMU/418-462:Q9CNI0:AE006080
LNK  Q9EZP0_BURCE/408-448:Q9EZP0:AF282898
LNK  Q9F3R6_9BURK/1-40:Q9F3R6:AJ278983
LNK  Q9HJ29_THEAC/4-45:Q9HJ29:AL445066
LNK  Q9HJ30_THEAC/5-48:Q9HJ30:AL445066
LNK  Q9KLU4_VIBCH/41-84:Q9KLU4:AE004394
LNK  Q9PM17_CAMJE/410-454:Q9PM17:AL139079
LNK  Q9RBP2_9NOCA/410-452:Q9RBP2:AJ249207
LNK  Q9WYF0_THEMA/6-50:Q9WYF0:AE001713
LNK  Q9ZC53_YERPE/411-455:Q9ZC53:AL031866
LNK  Q9ZNP4_COMTE/413-453:Q9ZNP4:AB006479
LNK  SILP_SALTY/45-88:Q9ZHC7:AF067954
LNK  TMOA_PSEME/407-447:Q00456:M65106
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  ATCU_RHILV/37-81
ASQ  PICGMTVDPQAGKPSLGHGGRIYHFCSEHCRTKFAAAPEDYLTAK
DSQ  CCCATCTGCGGCATGACCGTCGATCCGCAGGCCGGCAAGCCCTCACTCGGCCATGGCGGCCGCATCTATCATTTCTGTTCCGAGCATTGCCGAACGAAATTTGCGGCTGCACCCGAGGATTACCTGACGGCGAAG
TRN  11011101101011001
NAM  Q98C24_RHILO/36-80
ASQ  PVCGMTVDPAAGKPTSEHGGRLYHFCSERCRSKFQAEPEQYLTAT
DSQ  CCGGTCTGCGGCATGACCGTGGATCCGGCCGCCGGCAAGCCGACATCGGAGCATGGCGGTCGTCTCTATCATTTCTGCAGCGAGCGCTGCCGTTCGAAATTCCAGGCCGAGCCGGAACAATACCTGACGGCCACC
TRN  11011101101011011
NAM  Q98C24_RHILO/82-126
ASQ  PVCGMSVDRATARHLVRHEGQGFYFCSAGCKAKFEAAPQTYLGDR
DSQ  CCCGTCTGTGGCATGAGCGTCGACCGTGCCACAGCCAGGCACCTCGTTCGCCATGAAGGCCAGGGCTTCTATTTCTGTTCCGCCGGCTGCAAGGCGAAATTCGAGGCGGCACCGCAGACCTATCTCGGCGACAGG
TRN  10010101110011011
NAM  ATCU_RHILV/83-127
ASQ  PVCGMSVDRSTARYFLKAEGEKFYFCSAACQAKFEADPAAYRDGQ
DSQ  CCCGTCTGCGGCATGAGCGTCGATCGCTCGACGGCGAGATATTTCCTGAAAGCCGAGGGCGAGAAATTCTATTTCTGCTCGGCCGCGTGCCAGGCGAAGTTCGAAGCCGACCCTGCAGCCTACCGCGATGGCCAG
TRN  10010101100011011
NAM  Q9WYF0_THEMA/6-50
ASQ  PVCGMKIEKEEAAEKIEYMGKEYYFCSQECAEKFKDNPEQYAHQK
DSQ  CCCGTCTGCGGAATGAAGATCGAAAAAGAAGAAGCGGCAGAAAAGATAGAGTACATGGGGAAAGAGTACTACTTCTGTTCTCAAGAGTGTGCTGAAAAGTTCAAAGATAACCCGGAGCAGTATGCACACCAGAAA
TRN  10010101110011011
NAM  Q9HJ29_THEAC/4-45
ASQ  PVCGMKVDKN-AKFKSTYNGKEYYFCSEHCKVEFDRNPIKYTR--
DSQ  CCGGTCTGTGGAATGAAGGTTGATAAGAAC---GCGAAATTCAAATCGACGTACAACGGCAAGGAATATTATTTCTGCAGTGAGCACTGCAAGGTGGAATTTGACAGAAATCCGATAAAGTATACAAGA------
TRN  10010101110011011
NAM  Q9F3R6_9BURK/1-40
ASQ  ----MAVSTE-SKFRAEHDGKQYYFCSNSCHQKFLQEPAKYVGVK
DSQ  ------------ATGGCCGTATCGACGGAG---TCAAAATTCCGAGCCGAACACGATGGCAAGCAGTATTACTTTTGCAGCAACTCCTGCCATCAGAAGTTTCTGCAGGAGCCGGCGAAGTATGTGGGGGTGAAG
TRN  11011101101011001
NAM  Q46151_9GAMM/19-62
ASQ  PVCGMDVSKD-TQYQTEYKGQWYGFCCEGCLIKFNKDQDMYLSGK
DSQ  CCTGTATGTGGCATGGATGTTTCTAAAGAT---ACTCAGTACCAGACGGAATATAAGGGCCAATGGTATGGGTTTTGTTGTGAAGGCTGCCTGATAAAATTTAACAAAGATCAAGACATGTACCTGTCGGGTAAA
TRN  10010101100011011
NAM  SILP_SALTY/45-88
ASQ  -VCGMVILPDKAHSSIRYQDHQLYFCSASCESKFKAHPDHYFTED
DSQ  ---GTGTGCGGGATGGTCATCCTGCCTGACAAGGCGCACAGCAGCATTCGATACCAGGACCATCAGCTTTATTTCTGCTCCGCCAGCTGTGAGAGCAAATTTAAAGCCCATCCCGATCATTATTTTACCGAAGAT
TRN  11011101101011011
NAM  Q978Z8_THEVO/1-40
ASQ  ----MYVPET-SDLYVDKDGQRYYFCSKGCMEKFLSPEGESRSLK
DSQ  ------------ATGTATGTTCCAGAAACG---TCCGACCTTTACGTCGATAAAGATGGTCAACGTTATTATTTCTGTTCAAAGGGATGCATGGAAAAGTTTCTGTCTCCTGAAGGAGAGAGTCGAAGCCTAAAG
TRN  11011101101011001
NAM  Q9HJ30_THEAC/5-48
ASQ  PVCGMYVPET-SDLYVDRDGTRYYFCSKGCMDKFLEPEKEGKNLA
DSQ  CCAGTGTGCGGCATGTATGTCCCGGAGACC---TCAGATCTTTACGTTGACAGGGACGGCACAAGGTATTACTTCTGCTCCAAGGGATGCATGGACAAATTCCTAGAACCTGAAAAGGAGGGTAAAAACCTGGCC
TRN  10010101100011001
NAM  Q9RBP2_9NOCA/410-452
ASQ  -GSAFSLNDL-ADHSLTYNGRLYHFDSAISKWCFEQDPERYAGHQ
DSQ  ---GGATCGGCCTTCTCTCTGAACGACCTC---GCCGACCACAGCCTCACCTACAACGGGCGGCTTTACCACTTCGATTCCGCGATTTCCAAGTGGTGCTTCGAACAAGATCCGGAACGCTATGCCGGCCACCAG
TRN  11011111101111111
NAM  O87082_XANP2/408-446
ASQ  --DRFHLKPE----QLVYKGRLYTFDSDVSKWIFELDPERYAGHT
DSQ  ------GACCGCTTCCACCTGAAGCCCGAG------------CAGCTCGTCTACAAGGGGCGGCTCTACACCTTCGACAGCGACGTCTCCAAGTGGATCTTCGAGCTCGATCCGGAGCGCTATGCCGGCCACACC
TRN  11011111101111111
NAM  O87798_PSEST/408-448
ASQ  PGNKWNVKDY----QLEYEGRLYHFGSEADRWCFQIDPERYKNHT
DSQ  CCAGGTAATAAATGGAATGTAAAGGACTAC------------CAGCTCGAATATGAGGGACGCCTTTACCACTTCGGCTCTGAGGCCGACCGCTGGTGTTTCCAGATCGACCCGGAACGTTACAAAAACCATACG
TRN  11011101111011011
NAM  O07068_BURCE/409-449
ASQ  PGDAWAVKDY----QLEYNGRLYHFGSEPDRWCFEQEPERYAGHM
DSQ  CCGGGCGACGCGTGGGCGGTGAAAGATTAT------------CAGTTGGAATACAACGGGCGCCTCTATCACTTTGGTTCCGAACCTGATCGGTGGTGTTTCGAACAAGAACCGGAGCGATATGCCGGGCATATG
TRN  11011101111011011
NAM  Q9EZP0_BURCE/408-448
ASQ  PGNGWIVKDY----PLDYKGRTYHFNSEIDRWVFQQDPLRYRDHL
DSQ  CCGGGTAACGGCTGGATCGTGAAGGACTAC------------CCGCTCGACTACAAGGGCCGCACGTACCACTTCAATTCCGAGATCGACCGCTGGGTCTTCCAGCAGGACCCGCTGCGCTATCGCGACCACCTG
TRN  11011111101111111
NAM  TMOA_PSEME/407-447
ASQ  PGDDWNIEVF----SLEHNGRLYHFGSEVDRWVFQQDPVQYQNHM
DSQ  CCTGGTGATGACTGGAATATCGAAGTTTTC------------AGTCTTGAGCACAATGGGCGTCTTTATCATTTTGGCTCTGAAGTGGATCGCTGGGTATTCCAGCAAGATCCGGTTCAGTATCAAAATCATATG
TRN  11011111111111111
NAM  Q97YT0_SULSO/200-240
ASQ  PANGKYLRIY----LKEYKGKMYTFDSPACLWIFEQEPERYAGRR
DSQ  CCAGCTAATGGAAAGTACTTGAGGATCTAC------------TTAAAAGAGTATAAGGGAAAAATGTATACGTTTGATAGTCCCGCTTGCTTATGGATATTTGAACAAGAGCCAGAAAGATATGCTGGGAGAAGG
TRN  10010101110011010
NAM  O84961_9RALS/410-450
ASQ  PDDPTQTCYR----ESSYHGMKFHFCSDGCKDIFDGEPEKYAQAW
DSQ  CCGGACGATCCGACGCAGACCTGCTACCGC------------GAGAGCAGCTACCACGGCATGAAGTTCCACTTCTGCTCGGACGGCTGCAAGGACATCTTCGACGGCGAGCCCGAGAAGTATGCCCAGGCCTGG
TRN  11111111111111111
NAM  Q9ZNP4_COMTE/413-453
ASQ  PGDATKICYR----ESDYEGNKYHFCSDGCKHVFDDEPEKFVQSW
DSQ  CCCGGTGACGCCACCAAGATCTGCTATCGC------------GAGTCCGACTACGAGGGCAACAAGTACCACTTCTGCAGCGACGGCTGCAAGCATGTCTTCGACGATGAGCCCGAGAAGTTTGTCCAGTCCTGG
TRN  11111111111111111
NAM  O32431_ACISP/420-459
ASQ  -GDPTLFSYR----DSIYKDERYHTCSDGCHDIFEREPEKYIQAW
DSQ  ---GGCGACCCAACACTATTTAGCTATCGT------------GATTCAATTTACAAAGATGAGCGTTATCACACTTGCTCTGATGGTTGTCATGACATTTTTGAACGCGAACCTGAGAAATACATCCAAGCGTGG
TRN  11011101111011001
NAM  DMPN_PSESP/412-452
ASQ  PDDPTKLSLR----SLVHEGERYQFCSDGCCDIFKNEPVKYIQAW
DSQ  CCGGACGATCCGACCAAGCTCAGCCTGCGC------------AGCCTGGTGCACGAGGGGGAGCGCTATCAATTCTGCTCGGATGGCTGCTGCGACATCTTCAAGAACGAGCCGGTGAAGTACATCCAGGCCTGG
TRN  11011111101111111
NAM  Q9KLU4_VIBCH/41-84
ASQ  FTEGKPVKGA-AQFKTEYQGAEWLFASQQNLDAFLADPEKYAPQY
DSQ  TTCACCGAAGGCAAACCCGTTAAAGGGGCC---GCGCAGTTTAAAACTGAGTACCAAGGTGCCGAGTGGTTGTTTGCCTCTCAACAAAACCTCGACGCGTTTTTAGCTGACCCTGAAAAATACGCGCCGCAATAT
TRN  11011101111011010
NAM  Q9PM17_CAMJE/410-454
ASQ  PVSKTKVINTQAPFSYSYKGVTYYFSNQNNYEEFKKDPTKYVEEN
DSQ  CCTGTATCAAAAACAAAGGTTATAAACACCCAAGCTCCTTTTTCTTATAGCTATAAAGGGGTTACTTATTATTTTTCAAATCAAAACAACTATGAAGAATTTAAAAAAGATCCTACAAAATATGTAGAAGAAAAC
TRN  10010101110011001
NAM  Q9ZC53_YERPE/411-455
ASQ  PVDKSHLTNQKSEYKYSYGGKTYFFSSEANYNRFRDHPEQFVTPV
DSQ  CCGGTTGATAAGAGCCATCTGACCAATCAAAAATCCGAGTATAAATACAGCTATGGCGGGAAAACCTATTTCTTCTCCTCCGAGGCGAATTACAACCGTTTCCGCGATCACCCAGAACAGTTTGTCACGCCGGTA
TRN  11011101101011011
NAM  Q9CNI0_PASMU/418-462
ASQ  PVDHSQLKNTRTEHKYSYEGKTYFFATEKNLHLFRDAPENYLNAE
DSQ  CCTGTGGATCACAGTCAGCTGAAGAATACCCGTACTGAGCACAAATACAGTTACGAAGGCAAAACGTATTTCTTTGCTACGGAAAAAAATCTTCATTTATTCCGAGATGCCCCAGAAAATTACCTCAATGCAGAA
TRN  11011101101011010
//