EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04939 - RRS1)
FAM  PF04939
PID  RRS1
DES  Ribosome biogenesis regulatory protein (RRS1)
IPR  IPR007023
ANO  6
ALN  198
AID  0.401327
APH  (RRS1_HUMAN/22-197:0.19574,(Q8MR24_DROME/31-206:0.46147,RRS1_CAEEL/4-174:0.43464):0.19791,(Q8LA50_ARATH/1-177:0.75957,(RRS1_YEAST/9-203:0.40782,RRS1_SCHPO/1-164:0.42555):0.31901):0.24562);
ATP  (RRS1_HUMAN/22-197,(Q8MR24_DROME/31-206,RRS1_CAEEL/4-174),(Q8LA50_ARATH/1-177,(RRS1_YEAST/9-203,RRS1_SCHPO/1-164)));
ATL  3.44733
DNO  6
DLN  594
DID  0.485171
DPH  ((RRS1_HUMAN/22-197:0.32463,Q8MR24_DROME/31-206:0.32122):0.13589,((RRS1_SCHPO/1-164:0.36222,RRS1_YEAST/9-203:0.32206):0.22127,Q8LA50_ARATH/1-177:0.50332):0.13050,RRS1_CAEEL/4-174:0.30459);
DTP  ((RRS1_HUMAN/22-197,Q8MR24_DROME/31-206),((RRS1_SCHPO/1-164,RRS1_YEAST/9-203),Q8LA50_ARATH/1-177),RRS1_CAEEL/4-174);
DTL  2.6257
RID  0.401327
RPH  (RRS1_HUMAN/22-197:0.19574,(Q8MR24_DROME/31-206:0.46147,RRS1_CAEEL/4-174:0.43464):0.19791,(Q8LA50_ARATH/1-177:0.75957,(RRS1_YEAST/9-203:0.40782,RRS1_SCHPO/1-164:0.42555):0.31901):0.24562);
RTP  (RRS1_HUMAN/22-197,(Q8MR24_DROME/31-206,RRS1_CAEEL/4-174),(Q8LA50_ARATH/1-177,(RRS1_YEAST/9-203,RRS1_SCHPO/1-164)));
RTL  3.44733
LNK  Q8LA50_ARATH/1-177:Q8LA50:AY088030
LNK  Q8MR24_DROME/31-206:Q8MR24:AY122167
LNK  RRS1_CAEEL/4-174:Q9XVT0:Z81035
LNK  RRS1_HUMAN/22-197:Q15050:BC001811
LNK  RRS1_SCHPO/1-164:O59678:AL022299
LNK  RRS1_YEAST/9-203:Q08746:Z75202
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  RRS1_CAEEL/4-174
ASQ  KSTEVEKAIDPIIDLGNLLFIDRE-----------PIQGDASEGLEERARKNTQLLFNNIWQLEQKRVEEAI-----------IVTLPPATYRLPREKRLPEKKEPTKWEKYAAEKGIEKRKKD-KKVFDEATKEWKPTYGYRRGN-DDTKDWLIEIPDNA---EDPNKDFFAERREKKKERVAKNDMQRMKNLARQM
DSQ  AAATCGACGGAGGTTGAAAAGGCCATTGACCCAATCATTGACTTGGGTAACCTGCTGTTTATTGATCGAGAG---------------------------------CCAATCCAAGGAGACGCAAGTGAAGGACTCGAGGAACGTGCTAGGAAGAACACACAACTCCTTTTCAACAACATCTGGCAGCTGGAGCAAAAAAGAGTAGAAGAGGCTATT---------------------------------ATTGTTACTCTCCCTCCCGCCACTTACCGTCTTCCTCGTGAGAAACGATTGCCAGAGAAAAAAGAGCCGACGAAATGGGAGAAATATGCTGCTGAAAAGGGAATTGAGAAGAGAAAGAAGGAT---AAGAAGGTGTTCGATGAAGCGACAAAGGAATGGAAACCGACCTATGGATACAGACGTGGAAAT---GATGATACCAAGGATTGGCTGATCGAAATTCCTGACAACGCA---------GAAGATCCGAACAAGGATTTCTTTGCTGAGAGACGCGAAAAGAAGAAGGAGAGAGTTGCAAAGAACGATATGCAGAGAATGAAGAATCTTGCTCGTCAGATG
TRN  10010101100011011
NAM  RRS1_HUMAN/22-197
ASQ  QRITVHKELELQFDLGNLLASDRNPPTGLRCAGPTP--EAE---LQALARDNTQLLINQLWQLPTERVEEAI-----------VARLPEPTTRLPREKPLPRPRPLTRWQQFARLKGIRPKKKT-NLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEVPGNA----DPLEDQFAKRIQAKKERVAKNELNRLRNLARAH
DSQ  CAACGCATCACGGTGCACAAGGAGCTGGAGCTGCAGTTTGACCTGGGCAACCTGCTGGCGTCGGACCGGAACCCCCCGACCGGGCTGCGGTGCGCCGGACCCACGCCG------GAGGCCGAG---------CTACAGGCCCTGGCGCGGGACAACACGCAACTGCTCATCAACCAGCTGTGGCAGCTGCCCACGGAGCGCGTGGAAGAGGCGATA---------------------------------GTGGCGCGGCTGCCGGAGCCCACCACACGCCTGCCGCGAGAGAAGCCTCTGCCCCGACCGCGGCCACTTACACGCTGGCAGCAGTTCGCGCGCCTCAAGGGCATCCGTCCCAAGAAGAAGACC---AACCTGGTGTGGGACGAGGTGAGTGGCCAGTGGCGGCGGCGCTGGGGCTACCAGCGCGCCCGG---GACGACACCAAAGAATGGCTGATTGAGGTGCCCGGCAATGCC------------GACCCCTTGGAGGACCAGTTCGCCAAGCGGATTCAGGCCAAGAAGGAAAGGGTGGCCAAGAACGAGCTGAACCGGCTGCGTAACCTGGCCCGCGCGCAC
TRN  10010101100011011
NAM  Q8MR24_DROME/31-206
ASQ  KPITVEKHLECRLDVGSLLITDPN------DFDDRELRDNKEEYLTALTRENTQLLVNAIWELPTERVDESI-----------VAKLPEPTTVLPRLRKPPGPRPLTKWEKFAKEKGISKKKKD-KKTYDETMDKWVPTYGFKRAEAEKAKDWVLEVPQNA----DPNTDMFQKKIDLRNEKVAKNEIQRMKNIVRAK
DSQ  AAGCCGATCACAGTAGAAAAGCATTTGGAATGCCGACTCGACGTTGGCAGCCTGCTGATCACAGATCCCAAC------------------GATTTCGATGACCGGGAATTGAGGGACAACAAAGAGGAGTACCTGACCGCACTGACACGGGAGAACACCCAACTTTTGGTCAATGCCATTTGGGAGTTGCCCACCGAACGGGTAGACGAGAGCATT---------------------------------GTGGCCAAGCTGCCGGAACCCACGACGGTACTGCCCCGCCTCCGTAAGCCGCCAGGTCCACGTCCGCTCACCAAATGGGAGAAGTTCGCCAAGGAGAAGGGTATCAGCAAGAAGAAGAAGGAC---AAGAAGACCTACGATGAGACCATGGATAAATGGGTGCCTACATATGGTTTTAAGCGTGCCGAGGCCGAGAAGGCCAAGGATTGGGTGCTGGAGGTGCCACAGAACGCC------------GATCCCAATACGGACATGTTCCAGAAGAAGATCGACCTGCGCAACGAGAAGGTGGCCAAGAATGAGATCCAGCGGATGAAGAACATTGTGCGCGCCAAG
TRN  10010101100011011
NAM  RRS1_SCHPO/1-164
ASQ  MSAQIENSIPLDFDLGNMAAFDISPLDETKLSG-----SEKESFLFSLSRDNVQQLVNKMISLPKERTSDGV-----------LLQLPETVTPLPRAKPLPKPKPETKWQRFARIKGIAPKKREGRLVFDEASGEWVPKWGYKGKNKELETQWLVE------------------EGEKEKKLTSKQVRNTSKKIKRSR
DSQ  ATGTCTGCACAAATAGAAAACTCCATTCCTCTAGATTTCGATTTGGGAAATATGGCTGCATTTGATATTTCTCCCTTAGATGAAACTAAGCTTAGCGGT---------------TCAGAGAAAGAATCATTCCTTTTTTCTCTCAGTAGAGATAACGTTCAACAATTGGTGAACAAAATGATTTCCTTGCCTAAGGAGCGTACATCAGATGGCGTC---------------------------------CTTTTACAGCTTCCTGAAACTGTTACACCTCTTCCTCGTGCTAAACCTTTACCTAAACCCAAGCCCGAAACCAAATGGCAACGGTTTGCTCGTATTAAAGGTATTGCTCCTAAGAAGCGGGAAGGCAGGTTGGTGTTTGATGAAGCATCTGGTGAATGGGTACCAAAATGGGGTTATAAGGGTAAAAATAAGGAATTAGAGACACAATGGCTTGTTGAA------------------------------------------------------GAGGGAGAAAAGGAAAAGAAGCTTACTTCCAAGCAAGTGAGAAATACCTCAAAAAAAATCAAGCGCTCTCGT
TRN  10010101110011000
NAM  RRS1_YEAST/9-203
ASQ  LPVTVEKPIPVVYDLGNLAAFDSN---VLDKNDLDSSNARREEKIKSLTRDNVQLLINQLLSLPMKTTTESVGGTGGQSSVMTLLQLPDPTTDLPREKPLPKAKAMTKWEKFAAKKGIKPKERAGKMIYDEASGEWVPKWGYKGANKKLDDQWLVEVDDKVKGTDNELIDPRTLNRAERKRLVKKNEKQQRRNMKNAL
DSQ  TTACCAGTCACCGTTGAAAAGCCTATCCCAGTGGTATACGATTTGGGTAACCTGGCAGCATTCGATAGTAAT---------GTCTTGGATAAAAACGATTTAGATTCTTCGAATGCTAGGCGTGAAGAAAAGATAAAGAGTCTTACTCGTGATAATGTTCAGTTACTAATCAATCAACTATTATCACTACCTATGAAAACAACAACGGAGTCTGTAGGTGGCACCGGCGGTCAAAGTTCCGTGATGACCTTGTTGCAGCTTCCTGACCCTACCACTGACTTACCAAGAGAAAAGCCACTGCCAAAGGCTAAGGCTATGACCAAATGGGAGAAGTTTGCAGCTAAGAAGGGTATTAAACCAAAGGAAAGGGCAGGAAAGATGATTTATGATGAGGCATCCGGTGAATGGGTTCCAAAGTGGGGCTACAAGGGCGCAAATAAGAAGTTAGATGATCAATGGTTGGTGGAAGTTGATGATAAAGTAAAAGGCACTGACAATGAATTGATCGATCCAAGAACTTTGAATAGGGCAGAAAGAAAACGTTTAGTCAAGAAGAACGAAAAACAACAAAGGAGAAATATGAAGAATGCCTTA
TRN  10010101100011000
NAM  Q8LA50_ARATH/1-177
ASQ  MDTEMETEQIYQVDVGNLLAFNPNH----RFSSAPSSRGELVKEILTEGTKLVQEIANKLFNFPSTETNDGP-----------IVQLPPPTTKLPREKHIPRPKPPTKWEEFALKKGIQKRKKE-KVVWDEQTNQFKRRHGYDRVN-DDNDVPIIEAKESD----EPGVDPFAKRLDDKKKRVGKQEKNRLQNLKAAE
DSQ  ATGGACACCGAGATGGAGACAGAACAAATATACCAGGTCGATGTCGGAAATCTCTTGGCTTTCAATCCCAATCAC------------CGCTTCTCATCTGCTCCTTCTTCAAGGGGGGAGCTTGTGAAGGAGATCCTAACGGAGGGAACAAAACTTGTTCAGGAAATAGCCAATAAACTTTTCAACTTTCCTTCTACTGAAACAAATGATGGTCCT---------------------------------ATTGTCCAATTGCCTCCGCCTACAACCAAACTTCCTAGAGAGAAACATATTCCAAGGCCTAAGCCTCCTACGAAGTGGGAAGAGTTTGCGCTTAAGAAAGGTATACAGAAGCGCAAGAAGGAA---AAAGTTGTATGGGATGAACAAACTAATCAGTTTAAGCGTCGCCATGGTTATGACCGTGTTAAC---GATGATAATGATGTTCCCATCATTGAGGCGAAAGAATCAGAT------------GAACCAGGAGTAGATCCTTTTGCCAAGAGACTAGATGATAAGAAGAAGAGAGTTGGAAAGCAAGAAAAGAATAGACTTCAGAATCTGAAGGCTGCTGAA
TRN  10010101100011001
//