EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04924 - Pox_A6)
FAM  PF04924
PID  Pox_A6
DES  Poxvirus A6 protein
IPR  IPR007008
ANO  5
ALN  372
AID  0.492212
APH  (VA06_VARV/1-370:0.35879,(Q9DHL6_YLDV/1-371:0.16318,Q9Q8Y3_9POXV/1-371:0.20443):0.12975,(V170_FOWPV/1-372:0.66029,Q98276_MCV1/1-370:0.47783):0.23009);
ATP  (VA06_VARV/1-370,(Q9DHL6_YLDV/1-371,Q9Q8Y3_9POXV/1-371),(V170_FOWPV/1-372,Q98276_MCV1/1-370));
ATL  2.22436
DNO  5
DLN  1116
DID  0.543612
DPH  ((V170_FOWPV/1-372:0.52652,VA06_VARV/1-370:0.25881):0.13000,(Q98276_MCV1/1-370:0.67286,Q9Q8Y3_9POXV/1-371:0.10101):0.16992,Q9DHL6_YLDV/1-371:0.16342);
DTP  ((V170_FOWPV/1-372,VA06_VARV/1-370),(Q98276_MCV1/1-370,Q9Q8Y3_9POXV/1-371),Q9DHL6_YLDV/1-371);
DTL  2.02254
RID  0.492212
RPH  (VA06_VARV/1-370:0.35879,(Q9DHL6_YLDV/1-371:0.16318,Q9Q8Y3_9POXV/1-371:0.20443):0.12975,(V170_FOWPV/1-372:0.66029,Q98276_MCV1/1-370:0.47783):0.23009);
RTP  (VA06_VARV/1-370,(Q9DHL6_YLDV/1-371,Q9Q8Y3_9POXV/1-371),(V170_FOWPV/1-372,Q98276_MCV1/1-370));
RTL  2.22436
LNK  Q98276_MCV1/1-370:Q98276:U60315
LNK  Q9DHL6_YLDV/1-371:Q9DHL6:AJ293568
LNK  Q9Q8Y3_9POXV/1-371:Q9Q8Y3:AF170722
LNK  V170_FOWPV/1-372:Q9J563:AF198100
LNK  VA06_VARV/1-370:P33833:X69198
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  VA06_VARV/1-370
ASQ  MDKLRVLYDEFVTISKDNLERETGLSASDVDMDFDLNIFMTLVPVLEKKVCV-ITPTIEDDKIVTMMKYCSYQSFSFWFLKSGAVVKSVYNKLD-DAEKEKFVATFKDMLLNVQTLISLNSMYTRLRQDTEDIVSDSKKIMEIVSHLRASTTENAAYQVLQQNNSFIISTLNKILSDENYLLKIIAVFDSKLISEKETLNEYKQLYTISSESLVYGIRCVSNLDISSVQLSNNKYVLFVKKMLPKIILFQNNDINAQQFANVISKIYTLIYRQLTSNVDVGCLLTDTIESTKTKISVEKFKQTGINNVQSLIKFISDNKKEYKTIISEEYLSKEDRIITILQNIVNEHDIKYDNNLLNMRDLIVTFRERYSY
DSQ  ATGGACAAACTTAGAGTTCTATACGATGAGTTCGTCACCATTAGTAAAGATAATCTTGAACGCGAGACTGGTCTTAGCGCATCAGATGTTGATATGGATTTTGATTTAAACATTTTTATGACGTTGGTTCCAGTCTTGGAGAAAAAGGTATGTGTT---ATCACACCAACTATAGAAGATGATAAAATTGTAACTATGATGAAATATTGTAGTTATCAGAGTTTTTCATTCTGGTTTCTTAAATCTGGCGCCGTTGTAAAATCGGTATATAATAAACTAGAT---GATGCGGAAAAGGAAAAGTTTGTAGCCACATTTAAAGACATGTTGCTTAATGTACAAACTCTAATTTCTCTTAACTCTATGTATACTAGACTGCGTCAAGATACCGAAGATATAGTATCCGATTCCAAAAAAATAATGGAGATTGTTTCCCATTTGAGAGCGTCGACTACAGAGAATGCGGCGTATCAAGTTCTCCAACAAAACAATAGTTTTATCATATCTACACTAAATAAAATCTTATCTGATGAAAACTATCTTTTGAAAATTATTGCAGTATTTGACTCTAAACTAATTTCTGAAAAGGAGACATTGAATGAATACAAACAATTGTACACCATTTCTTCTGAAAGTTTGGTATATGGAATCAGATGCGTTAGTAATCTGGATATATCATCTGTTCAACTGAGTAACAATAAATACGTTCTCTTTGTTAAGAAAATGCTACCTAAAATCATACTGTTTCAGAATAACGACATCAACGCACAACAATTTGCTAATGTTATTTCTAAAATTTATACTCTAATTTATAGACAATTAACGTCGAATGTCGATGTTGGGTGTCTATTAACAGACACAATAGAATCTACCAAAACTAAAATATCTGTAGAAAAATTTAAACAAACGGGTATTAATAATGTTCAAAGTCTTATTAAATTTATATCGGATAACAAGAAAGAATATAAGACAATAATCTCTGAAGAATATCTATCGAAGGAAGATAGAATCATTACTATTTTGCAAAATATCGTTAATGAACACGATATAAAGTACGACAATAACCTGCTAAATATGAGAGACTTGATTGTGACATTTAGAGAACGATATTCGTAT
TRN  10010101100011000
NAM  Q9Q8Y3_9POXV/1-371
ASQ  MDKLKVLYEDFYRISKLYLEKETQSTTLAPDFDVDVSVFMNLVPVLEQKVVP-VNADIEDDDVLRMMKYCNYKLFSFWFLKSNAVVKSVYNKLETDDEKRNFTKLFRGILTNVQTLISINNMYNNIKQDTVDIVSDSKKIIDIVNQIKNANCESSAYKLLQTNYNFIVKTINKILSDENYLLKIIAVFDSKLVTDKDKLTEYREIFTISTESIIYGIRCISDLDIPTIEVENNKYVAFFKKIMGTVILFQNNDLNPQKFIHAVSKLYVLIHQQFKTNPEVAYLLTDVLDSIKTKISVDEIKQKGVNNLQSLIKFISDNKTSYKVILSDEYTKREDSIIDILQSISEENRIEHGGKVINIRYLIDITKNRFFS
DSQ  ATGGATAAGTTAAAAGTTTTATACGAGGACTTTTACCGTATCAGTAAACTATACTTGGAAAAGGAAACACAATCGACGACACTCGCTCCGGATTTTGATGTAGATGTATCCGTTTTTATGAATCTAGTACCCGTACTCGAACAAAAAGTGGTTCCC---GTAAACGCTGATATCGAGGACGATGACGTTCTACGTATGATGAAATATTGTAATTACAAATTGTTTTCATTTTGGTTTTTGAAGTCCAATGCGGTGGTTAAATCCGTCTACAACAAACTAGAAACAGATGATGAAAAACGTAATTTCACGAAACTGTTTAGGGGCATACTAACAAACGTTCAAACGCTTATTTCCATCAACAATATGTATAATAACATAAAACAGGATACTGTAGATATCGTCTCCGACTCAAAGAAAATAATCGACATCGTGAATCAAATAAAGAACGCAAATTGTGAAAGTAGTGCTTATAAACTGTTACAGACCAATTATAACTTTATCGTTAAAACGATTAATAAAATATTATCGGACGAAAACTATCTGCTCAAGATTATCGCGGTCTTTGATTCCAAGTTAGTAACGGACAAGGACAAACTTACCGAGTACAGGGAGATTTTTACCATCTCCACGGAAAGTATCATCTACGGAATACGGTGCATATCCGATCTAGATATACCCACCATCGAAGTCGAGAACAACAAATACGTCGCCTTCTTTAAGAAGATAATGGGGACGGTTATCCTGTTTCAAAACAACGACTTGAATCCGCAAAAGTTTATCCATGCTGTGTCAAAACTGTACGTATTAATCCATCAACAGTTTAAAACGAATCCAGAGGTCGCGTATCTGTTAACGGACGTTCTCGATTCGATAAAAACGAAAATATCAGTAGACGAAATAAAGCAGAAAGGCGTAAACAATCTACAATCCCTGATTAAGTTTATCTCGGACAATAAGACGTCGTACAAAGTTATTCTATCAGACGAATACACCAAACGGGAAGATTCCATCATCGACATTCTACAATCCATATCCGAGGAAAATCGTATAGAACACGGAGGTAAGGTCATCAATATAAGATATTTGATAGACATCACAAAAAATAGGTTCTTTTCG
TRN  10010101100011000
NAM  Q9DHL6_YLDV/1-371
ASQ  MDKLKILYNDFYKTSKKYLEQETNTKTLEANFELDVSILMNLVPILEKKVTF-ITSSITDENIILMMKYCNYKLFSFWFLKSGAVVKSVYNKLESDIEKEQFKNIFKEMLLNVQTLISLNNMYTNLKQDTAEIVSDSKKIIEIVNQIKNSTCESSAYHLLQNNYSFIVKTINKVLSDENYLLKMIAVFDSNLINDKNKLNEYREIFTISSNSIIYGIKCVSELEMPTIDIDNNKYVSFFKKVLCNVILFQNNDLNSHRFINVVSKLYVLIQQQLMTNPLVACLLTDVLDSIKAKISVEEIKQKGVRNFQSLIKFISENKSSYKLIISAEYIKREQQIIEILQTISNENKIEHNGKIIDVSNLIKITKNRFFN
DSQ  ATGGATAAGCTTAAAATTTTGTATAATGATTTTTACAAAACAAGCAAAAAATATTTGGAACAGGAAACTAATACAAAAACATTAGAAGCTAATTTTGAATTAGATGTTTCTATATTAATGAACTTAGTGCCTATATTGGAAAAAAAAGTAACGTTT---ATAACTTCTTCTATAACAGATGAAAATATAATCTTAATGATGAAATATTGCAATTACAAATTATTTTCATTTTGGTTTTTAAAATCTGGAGCTGTTGTTAAATCAGTATATAACAAGCTAGAATCAGATATAGAAAAAGAACAGTTTAAAAATATATTTAAGGAAATGTTACTAAATGTTCAGACGCTAATATCACTAAATAATATGTATACAAATTTAAAACAAGATACTGCAGAAATAGTATCTGATTCAAAAAAAATTATAGAAATAGTAAACCAAATTAAAAATTCAACATGTGAAAGCAGTGCTTATCATTTACTACAAAACAACTATAGTTTTATAGTAAAAACAATTAATAAAGTATTGTCTGACGAAAACTACCTGTTAAAGATGATAGCTGTTTTTGACTCTAATTTAATTAATGACAAGAACAAATTAAACGAATACAGAGAAATTTTTACAATATCTTCAAATAGCATTATTTATGGAATAAAATGTGTATCGGAACTTGAAATGCCAACGATAGATATAGACAACAATAAGTATGTATCTTTTTTTAAAAAAGTGCTATGTAACGTTATCTTATTTCAAAATAATGACTTAAATTCACACAGATTTATAAATGTTGTTTCTAAACTATACGTATTAATACAACAACAACTTATGACAAATCCTTTGGTAGCTTGTTTGTTAACTGATGTTTTGGATTCAATAAAAGCTAAAATATCTGTTGAAGAAATAAAACAAAAAGGAGTACGTAATTTTCAATCATTAATAAAATTTATATCGGAAAACAAGTCTTCTTATAAATTAATAATTTCTGCAGAATATATAAAACGAGAACAACAAATTATAGAAATATTACAAACGATATCTAATGAAAATAAAATAGAACATAATGGAAAAATTATAGATGTTAGTAATTTGATTAAAATAACAAAAAACAGGTTTTTTAAT
TRN  10010101100011000
NAM  Q98276_MCV1/1-370
ASQ  MDRFRALYGEFCRLSVEHLERETGTRADAVDVDVDVDTMLSLLPILERKVCA-LHAA-SDEQLLLFMKYFNYKVLSFWFLRSDAVVKSLYNRLQDEPARAHFRELFRALLASTQTLVSLNAMYRNIKQDTADIIADSKKILEIVAQVRATTCEQQAYRLLSSNYNFLVKTANKVLSDENYLLKLIALFNTELVQDRERMEEYRELFSLSAENAVHGIRCMCDVSVEAVDFAGSRYSAFFRRVLSNVLLFQTHGLNAQRFVQIVSKLYTLIHSELTQNAALAEMLSAVLDSIKDRLSVDELRQHGVRNLQSLVRYIASRREFYRELLLGEWRAREDTLVHLLQEIVTRNGVQFRESPVDVAAVLRALKEQVFS
DSQ  ATGGACCGGTTCCGTGCGCTCTACGGCGAGTTCTGCCGGCTCAGCGTGGAGCACCTGGAACGCGAGACGGGCACGCGCGCAGACGCGGTGGACGTGGACGTGGACGTGGATACCATGCTCTCGCTGCTGCCCATACTCGAACGCAAGGTGTGCGCG---CTGCACGCCGCC---AGCGACGAGCAGCTGCTTCTCTTCATGAAATACTTCAACTACAAGGTGCTGTCCTTCTGGTTCCTGCGCTCCGACGCGGTGGTGAAATCGCTGTACAACCGCCTGCAGGACGAGCCCGCGCGCGCGCATTTCCGCGAGCTCTTCCGCGCGCTCCTGGCGAGCACGCAGACGCTGGTTTCGCTGAACGCCATGTACCGCAACATCAAGCAGGACACGGCGGACATCATTGCCGACTCCAAGAAGATCCTGGAGATCGTGGCGCAGGTGCGTGCGACCACGTGCGAGCAGCAAGCCTACCGGCTGCTCAGTAGCAACTACAACTTCCTGGTGAAGACGGCCAACAAGGTCCTGTCGGACGAGAACTACCTGCTGAAACTGATCGCGCTCTTCAACACCGAGCTGGTGCAGGACCGCGAGCGCATGGAAGAGTACCGCGAGCTCTTCTCGCTGTCGGCCGAGAACGCCGTGCACGGCATCCGCTGCATGTGCGACGTCAGTGTGGAGGCCGTAGACTTCGCCGGCAGCCGCTACAGCGCGTTTTTCCGGCGCGTGCTCAGCAACGTGCTGCTCTTCCAGACGCACGGTCTGAACGCGCAGCGCTTCGTACAGATCGTGAGCAAGCTGTACACGCTGATCCACAGCGAGCTCACGCAGAACGCCGCGCTCGCCGAGATGCTCAGTGCCGTGCTCGACTCCATCAAGGACAGGCTCTCTGTGGACGAGCTGCGCCAGCACGGCGTGCGCAACCTGCAGTCGCTGGTACGCTACATTGCCAGCCGGCGCGAGTTCTACCGCGAGCTGCTGCTTGGAGAATGGCGCGCGCGCGAGGACACGCTAGTGCACTTGCTGCAGGAGATTGTCACGCGCAACGGCGTCCAGTTCCGCGAGAGCCCGGTTGACGTCGCCGCGGTGCTGCGCGCGCTGAAAGAACAGGTCTTCTCG
TRN  10010101100011011
NAM  V170_FOWPV/1-372
ASQ  MEKFRNAFIEFYELSKKYLENSTGQKVYEVNYDNDIDSFLTVFPILESKIGGDINCAMSDETVILAMQQVEFKMFTFWYMRSAANVKSMLNKITDKETKEQFIRIFKDMLVYAKVITSINNMYSNMKKDTNEIVQDLKKILGIVSLIKSANNEHQAYKILMENNSFIIRTINKVLADSNYIIKIIALFNTDVVSDKIKLEEYKDVFSFSKENVIFGIKCFCDITIDGIDQINNKYVSFFKKVLPNIILFQTSCVKTTQFVNIFSKLSSIVYSEILTNERLHVLFSEIMASFKTKVSVEDLKKRKVNNIQGLISEISNNREMYKNIFVEEYEKHKTTLISIVQCITDNYNINYKENAVDIEFIFDFIQEHYIS
DSQ  ATGGAAAAGTTCAGGAATGCATTTATTGAATTTTATGAATTAAGTAAGAAGTATTTAGAGAATAGTACAGGTCAAAAAGTGTATGAAGTAAATTATGATAATGATATCGATTCATTTTTAACGGTTTTTCCTATTCTAGAAAGTAAGATAGGCGGTGATATTAACTGCGCAATGTCTGACGAGACTGTTATTCTAGCCATGCAGCAAGTAGAATTCAAGATGTTTACATTTTGGTATATGCGATCAGCGGCAAACGTAAAATCTATGCTCAACAAAATAACAGATAAAGAAACAAAAGAACAGTTTATCAGAATATTTAAAGATATGTTAGTATATGCAAAAGTTATTACATCTATAAACAATATGTACTCTAATATGAAAAAAGATACAAATGAAATAGTGCAGGATTTAAAAAAGATACTAGGAATTGTGTCGTTAATTAAAAGTGCTAATAACGAACATCAAGCTTACAAAATATTAATGGAAAACAATAGTTTCATTATCAGAACAATAAATAAAGTCCTAGCGGATAGCAATTATATCATAAAGATAATTGCACTTTTTAATACAGATGTAGTATCTGATAAGATAAAACTTGAAGAATATAAAGATGTATTTTCTTTCTCTAAAGAAAACGTAATATTTGGTATTAAGTGTTTCTGCGATATAACGATAGACGGTATAGACCAGATAAATAATAAATACGTAAGCTTCTTTAAAAAGGTATTACCTAATATTATTTTATTTCAAACTAGCTGTGTCAAAACAACACAATTTGTTAACATATTTTCTAAACTCTCTAGTATAGTGTATTCTGAAATACTTACTAACGAACGCTTACACGTTCTTTTTAGTGAAATAATGGCATCATTTAAGACTAAAGTTTCCGTAGAAGATTTAAAGAAAAGAAAGGTTAATAACATTCAGGGATTGATAAGTGAGATATCAAATAACCGTGAAATGTATAAAAACATATTTGTGGAAGAATATGAAAAGCACAAAACAACACTTATATCAATTGTTCAATGTATAACCGATAATTACAACATTAACTATAAAGAAAATGCTGTAGATATAGAATTCATATTCGATTTTATTCAAGAACATTATATATCT
TRN  10010101110011000
//