EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04877 - HrpZ)
FAM  PF04877
PID  HrpZ
DES  HrpZ
IPR  IPR006961
ANO  2
ALN  345
AID  0.816456
APH  (Q52481_PSESX/1-345:0.15511,HRPZ_PSESY/1-341:0.09102);
ATP  (Q52481_PSESX/1-345,HRPZ_PSESY/1-341);
ATL  0.24613
DNO  2
DLN  1035
DID  0.786901
DPH  (Q52481_PSESX/1-345:0.25491,HRPZ_PSESY/1-341:0.00000);
DTP  (Q52481_PSESX/1-345,HRPZ_PSESY/1-341);
DTL  0.25491
RID  0.816456
RPH  (Q52481_PSESX/1-345:0.15511,HRPZ_PSESY/1-341:0.09102);
RTP  (Q52481_PSESX/1-345,HRPZ_PSESY/1-341);
RTL  0.24613
LNK  HRPZ_PSESY/1-341:P35674:L14775
LNK  Q52481_PSESX/1-345:Q52481:L41862
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q52481_PSESX/1-345
ASQ  MQSLSLNSSTLQSPSMALVLIRPETETTGPSTSSRALQEVIAQLAQELTHNGQLDESSPLGKLLGKAMAASGKAGGGLEDIKAALDTLIHEKLGDNFGASADNASDTGQHDLMTQVLNGLAKSMLNDLLTKQDDGTRFSEDDMPMLKKIAEFMDDNPAQFPKPDSGSWVNELKEDNFLDGDETAQFRSALDIIGQQLGSQQNAAGGLAGDSSGGGLGSPVSNTENSPGSLGDPLIDANTGPASNSNSNGDVGQLIGELIDRGLQSVLAGGGLGTPVSTANTALVPGGEQPNQDLGQLLGGLLQKGLEATLQDAGQTGTGVQSSTAQVALLLVNMLLQSTKNQAAA
DSQ  ATGCAGAGTCTCAGTCTTAACAGCAGCACGCTGCAAAGCCCGTCGATGGCGCTCGTTCTGATCCGTCCTGAAACCGAGACAACCGGGCCGAGTACATCCAGCCGGGCGCTTCAGGAAGTGATTGCGCAGCTTGCCCAGGAGCTGACTCACAATGGTCAACTGGACGAGAGTTCGCCATTGGGCAAGTTGCTCGGCAAAGCGATGGCCGCCAGTGGCAAGGCTGGCGGCGGCCTCGAGGACATCAAGGCTGCGCTGGACACGCTTATCCACGAAAAGCTGGGCGACAATTTTGGCGCTTCTGCCGACAACGCCTCGGATACCGGACAACACGACTTGATGACACAGGTGCTCAATGGCCTGGCCAAGTCGATGCTGAATGATCTTCTGACCAAGCAGGATGACGGAACTCGTTTTTCCGAGGACGACATGCCGATGCTGAAAAAGATCGCGGAGTTCATGGACGACAACCCCGCACAGTTTCCCAAACCGGACTCGGGTTCGTGGGTGAACGAACTCAAGGAAGATAACTTCCTCGACGGCGACGAAACAGCGCAGTTCCGCTCGGCACTCGACATCATCGGCCAGCAATTGGGCAGTCAACAGAATGCAGCCGGCGGTCTGGCGGGCGATAGCAGCGGTGGTGGCCTGGGCAGCCCTGTGAGCAATACGGAAAATTCGCCTGGTTCACTGGGTGATCCGCTTATCGACGCTAACACCGGCCCCGCCAGCAACAGCAATTCCAATGGTGATGTGGGCCAGTTGATCGGTGAGCTGATAGACCGGGGACTGCAATCGGTATTGGCCGGTGGCGGCTTGGGAACACCTGTGAGCACCGCCAATACTGCCCTTGTGCCTGGCGGCGAACAGCCGAATCAGGACCTGGGTCAGTTACTCGGTGGCTTGTTGCAGAAAGGTCTGGAAGCGACGCTTCAGGATGCTGGCCAGACCGGGACCGGCGTGCAGTCCAGCACTGCTCAAGTTGCCTTGCTGCTGGTCAACATGCTGCTGCAAAGCACTAAAAACCAGGCTGCTGCC
TRN  10010101100011000
NAM  HRPZ_PSESY/1-341
ASQ  MQSLSLNSSSLQTPAMALVLVRPEAETTG-STSSKALQEVVVKLAEELMRNGQLDDSSPLGKLLAKSMAADGKAGGGIEDVIAALDKLIHEKLGDNFGASADSASGTGQQDLMTQVLNGLAKSMLDDLLTKQDGGTSFSEDDMPMLNKIAQFMDDNPAQFPKPDSGSWVNELKEDNFLDGDETAAFRSALDIIGQQLGNQQSDAGSLAG--TGGGLGTPSSFSNNSS-VMGDPLIDANTGPGDSGNTRGEAGQLIGELIDRGLQSVLAGGGLGTPVNTPQTGTSANGGQSAQDLDQLLGGLLLKGLEATLKDAGQTGTDVQSSAAQIATLLVSTLLQGTRNQAAA
DSQ  ATGCAGAGTCTCAGTCTTAACAGCAGCTCGCTGCAAACCCCGGCAATGGCCCTTGTCCTGGTACGTCCTGAAGCCGAGACGACTGGC---AGTACGTCGAGCAAGGCGCTTCAGGAAGTTGTCGTGAAGCTGGCCGAGGAACTGATGCGCAATGGTCAACTCGACGACAGCTCGCCATTGGGAAAACTGTTGGCCAAGTCGATGGCCGCAGATGGCAAGGCGGGCGGCGGTATTGAGGATGTCATCGCTGCGCTGGACAAGCTGATCCATGAAAAGCTCGGTGACAACTTCGGCGCGTCTGCGGACAGCGCCTCGGGTACCGGACAGCAGGACCTGATGACTCAGGTGCTCAATGGCCTGGCCAAGTCGATGCTCGATGATCTTCTGACCAAGCAGGATGGCGGGACAAGCTTCTCCGAAGACGATATGCCGATGCTGAACAAGATCGCGCAGTTCATGGATGACAATCCCGCACAGTTTCCCAAGCCGGACTCGGGCTCCTGGGTGAACGAACTCAAGGAAGACAACTTCCTTGATGGCGACGAAACGGCTGCGTTCCGTTCGGCACTCGACATCATTGGCCAGCAACTGGGTAATCAGCAGAGTGACGCTGGCAGTCTGGCAGGG------ACGGGTGGAGGTCTGGGCACTCCGAGCAGTTTTTCCAACAACTCGTCC---GTGATGGGTGATCCGCTGATCGACGCCAATACCGGTCCCGGTGACAGCGGCAATACCCGTGGTGAAGCGGGGCAACTGATCGGCGAGCTTATCGACCGTGGCCTGCAATCGGTATTGGCCGGTGGTGGACTGGGCACACCCGTAAACACCCCGCAGACCGGTACGTCGGCGAATGGCGGACAGTCCGCTCAGGATCTTGATCAGTTGCTGGGCGGCTTGCTGCTCAAGGGCCTGGAGGCAACGCTCAAGGATGCCGGGCAAACAGGCACCGACGTGCAGTCGAGCGCTGCGCAAATCGCCACCTTGCTGGTCAGTACGCTGCTGCAAGGCACCCGCAATCAGGCTGCAGCC
TRN  11011101101011011
//