EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04831 - Popeye)
FAM  PF04831
PID  Popeye
DES  Popeye protein conserved region
IPR  IPR006916
ANO  2
ALN  154
AID  0.592105
APH  (POPD2_HUMAN/107-260:0.36971,POPD3_CHICK/107-260:0.18940);
ATP  (POPD2_HUMAN/107-260,POPD3_CHICK/107-260);
ATL  0.55911
DNO  2
DLN  462
DID  0.595238
DPH  (POPD2_HUMAN/107-260:0.53013,POPD3_CHICK/107-260:0.06232);
DTP  (POPD2_HUMAN/107-260,POPD3_CHICK/107-260);
DTL  0.59245
RID  0.592105
RPH  (POPD2_HUMAN/107-260:0.24960,POPD3_CHICK/107-260:0.30950);
RTP  (POPD2_HUMAN/107-260,POPD3_CHICK/107-260);
RTL  0.55911
LNK  POPD2_HUMAN/107-260:Q9HBU9:AF204173
LNK  POPD3_CHICK/107-260:Q9DG25:AF204170
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  POPD2_HUMAN/107-260
ASQ  EFDLLYKTLCLPLQVPLQTYKEIVHCCEEQVLTLATEQTYAVEGETPINRLSLLLSGRVRVSQDGQFLHYIFPYQFMDSPEWESLQPSEEGVFQVTLTAETSCSYISWPRKSLHLLLTKERYISCLFSALLGYDISEKLYTLNDKLFAKFGLRF
DSQ  GAGTTTGACCTCCTCTACAAGACGCTGTGCCTGCCCTTGCAGGTGCCCCTACAGACATACAAGGAGATTGTTCACTGCTGCGAGGAGCAGGTCTTAACTCTGGCCACTGAACAGACCTATGCTGTGGAGGGTGAGACACCCATCAACCGCCTGTCCCTGCTGCTCTCTGGCCGGGTTCGTGTGAGCCAGGATGGGCAGTTTCTGCACTACATCTTTCCATACCAGTTCATGGACTCTCCTGAGTGGGAATCACTACAGCCTTCTGAGGAGGGGGTGTTCCAGGTCACTCTGACTGCTGAGACCTCATGTAGCTACATTTCCTGGCCCCGGAAAAGTCTCCATCTTCTTCTGACCAAAGAGCGATACATCTCCTGCCTCTTCTCGGCTCTGCTGGGATATGACATCTCGGAGAAGCTCTACACTCTCAATGACAAGCTCTTTGCTAAGTTTGGGCTGCGCTTT
TRN  11011101101011000
NAM  POPD3_CHICK/107-260
ASQ  EFQELYSALFQPLGISLTVYRKIVLCCDAEVITLEKEHCYAMQGKTPIDKLSLLVSGRIRVTVDGEFLHYIFPLQFLDSPEWDSLRPTEEGIFQVTLTAETDCRYVAWRRKKLYLLFAKHRFISRLFSILIGSDIAEKLYALNDRVHVGKGFRY
DSQ  GAATTCCAGGAACTCTACAGCGCTCTCTTCCAGCCTCTAGGAATTTCTTTAACTGTCTACAGGAAGATTGTCTTGTGCTGTGATGCAGAAGTGATTACCCTGGAGAAGGAGCACTGTTATGCTATGCAAGGCAAAACGCCTATTGACAAACTGTCTTTGCTTGTATCAGGCAGGATCAGAGTGACAGTTGATGGGGAGTTTCTGCATTATATTTTTCCTCTTCAGTTTCTGGATTCTCCTGAATGGGATTCACTGAGACCCACAGAAGAGGGAATTTTCCAGGTAACGCTTACAGCAGAGACAGATTGTCGGTATGTGGCCTGGAGGAGAAAGAAGCTGTATTTGCTGTTTGCTAAGCACCGTTTCATCTCACGCCTGTTCTCAATTTTAATCGGGAGCGACATCGCCGAAAAACTGTATGCCCTGAATGACAGGGTGCACGTGGGGAAGGGGTTTAGGTAT
TRN  10010101100011000
//