EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04827 - DUF635)
FAM  PF04827
PID  DUF635
DES  Protein of unknown function (DUF635)
IPR  IPR006912
ANO  9
ALN  112
AID  0.536069
APH  ((((Q9SH78_ARATH/72-176:0.31156,((Q9AY86_ORYSA/44-154:0.34858,(Q9AY56_ORYSA/265-375:0.15626,Q9LI58_ORYSA/161-271:0.23154):0.23527):0.10802,Q9FYM5_ARATH/182-292:0.41231):0.06376):0.19298,Q9LDY0_ARATH/255-365:0.12382):0.15925,Q9ST09_BRACM/10-121:0.41364):0.10326,Q9LHR9_ARATH/6-114:0.13965,Q9C845_ARATH/155-266:0.37804);
ATP  ((((Q9SH78_ARATH/72-176,((Q9AY86_ORYSA/44-154,(Q9AY56_ORYSA/265-375,Q9LI58_ORYSA/161-271)),Q9FYM5_ARATH/182-292)),Q9LDY0_ARATH/255-365),Q9ST09_BRACM/10-121),Q9LHR9_ARATH/6-114,Q9C845_ARATH/155-266);
ATL  3.39835
DNO  8
DLN  336
DID  0.580579
DPH  (Q9SH78_ARATH/72-176:0.29016,(Q9FYM5_ARATH/182-292:0.32673,(Q9AY86_ORYSA/44-154:0.26235,Q9AY56_ORYSA/265-375:0.28925):0.06252):0.04783,((Q9ST09_BRACM/10-121:0.30800,(Q9C845_ARATH/155-266:0.26720,Q9LHR9_ARATH/6-114:0.09683):0.11776):0.13138,Q9LDY0_ARATH/255-365:0.06113):0.14641);
DTP  (Q9SH78_ARATH/72-176,(Q9FYM5_ARATH/182-292,(Q9AY86_ORYSA/44-154,Q9AY56_ORYSA/265-375)),((Q9ST09_BRACM/10-121,(Q9C845_ARATH/155-266,Q9LHR9_ARATH/6-114)),Q9LDY0_ARATH/255-365));
DTL  2.40755
RID  0.528469
RPH  ((((((Q9AY86_ORYSA/44-154:0.32295,Q9AY56_ORYSA/265-375:0.32695):0.12878,Q9FYM5_ARATH/182-292:0.38258):0.09710,Q9SH78_ARATH/72-176:0.31273):0.19073,Q9LDY0_ARATH/255-365:0.12412):0.15535,Q9ST09_BRACM/10-121:0.41434):0.10387,Q9LHR9_ARATH/6-114:0.13948,Q9C845_ARATH/155-266:0.37862);
RTP  ((((((Q9AY86_ORYSA/44-154,Q9AY56_ORYSA/265-375),Q9FYM5_ARATH/182-292),Q9SH78_ARATH/72-176),Q9LDY0_ARATH/255-365),Q9ST09_BRACM/10-121),Q9LHR9_ARATH/6-114,Q9C845_ARATH/155-266);
RTL  3.09445
LNK  Q9AY56_ORYSA/265-375:Q9AY56:AC084763
LNK  Q9AY86_ORYSA/44-154:Q9AY86:AC084319
LNK  Q9C845_ARATH/155-266:Q9C845:AC035249
LNK  Q9FYM5_ARATH/182-292:Q9FYM5:AC000103
LNK  Q9LDY0_ARATH/255-365:Q9LDY0:AP000413
LNK  Q9LHR9_ARATH/6-114:Q9LHR9:AP002031
LNK  Q9LI58_ORYSA/161-271:Q9LI58:
LNK  Q9SH78_ARATH/72-176:Q9SH78:AC007662
LNK  Q9ST09_BRACM/10-121:Q9ST09:AB022081
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9LI58_ORYSA/161-271
ASQ  LEQVRGEAPRVHFSVNGNEYNNGYYL-ADGIYPYWASFIKSISLPQTEKHKLFAKRQEGARKDVERAFGVLQARFNIVRRPAKKWKRKSVGKIMLACVILHNMIVEDEREDA
NAM  Q9AY56_ORYSA/265-375
ASQ  IEAIKGEAPQIQFIVNGTQYNTGYYL-ADGIYPEWAAFVKSIRSPQLEKHKLFAREQEGKRKDIERAFGVLQARFNIVHRPARSWSQKVLRKIMQACVILHNMIVEDEGEMA
DSQ  ATTGAAGCAATAAAAGGTGAAGCTCCCCAAATCCAATTTATTGTCAATGGGACACAATACAACACGGGATATTATCTT---GCTGATGGAATTTATCCGGAATGGGCAGCCTTTGTAAAGTCTATAAGATCTCCTCAACTAGAGAAGCACAAGCTGTTTGCAAGGGAACAAGAAGGGAAACGGAAAGATATTGAGCGTGCTTTTGGGGTGTTGCAAGCTCGCTTCAACATCGTGCATCGTCCAGCACGATCATGGAGCCAAAAAGTTCTTCGAAAAATCATGCAAGCTTGTGTAATTCTCCACAACATGATAGTGGAAGACGAGGGAGAAATGGCA
TRN  10010101100011001
NAM  Q9SH78_ARATH/72-176
ASQ  DDIEQGNTPRVNFFVYQRQYNMAYYL-ADGIYPSYPTFVKSIRLPQSEPDKLFVQLQEGCRKDIERAFGVLHARFKII------WNIADLAIIMRSCIILHNMIVENERDTY
DSQ  GATGACATTGAACAAGGAAATACTCCAAGAGTGAACTTCTTCGTGTACCAACGTCAATACAATATGGCATATTATCTA---GCTGACGGTATCTATCCGTCTTATCCAACTTTTGTGAAGTCCATTAGACTTCCTCAGAGTGAACCAGACAAGTTATTCGTACAACTTCAGGAGGGATGTCGGAAAGATATCGAACGTGCATTTGGAGTATTACATGCTCGATTTAAAATAATT------------------TGGAACATAGCTGATTTAGCTATCATCATGAGGTCATGTATCATATTGCATAATATGATTGTTGAGAATGAACGAGATACATAT
TRN  10010101110011000
NAM  Q9AY86_ORYSA/44-154
ASQ  TDILMGTSTRLRYTVNGIQYDLGYYL-ADGIYPEWATIVKSIRHPQLEKHKLFAQQQESARKDAECAFGLLGARFKVVATTTHLWEQSDISNIMTACIIMYNMIVEDEGHLD
DSQ  ACTGACATACTAATGGGGACATCAACAAGGCTGCGATACACAGTAAATGGAATTCAATATGACTTGGGTTACTATCTA---GCCGATGGAATCTATCCAGAGTGGGCGACTATTGTTAAGTCGATCCGACATCCTCAATTGGAGAAGCACAAACTATTTGCTCAACAACAAGAATCAGCAAGGAAGGATGCCGAATGTGCATTTGGTTTACTCGGAGCTCGTTTCAAGGTGGTCGCGACTACTACTCACTTATGGGAGCAATCAGACATATCCAATATAATGACAGCATGTATTATAATGTACAATATGATTGTAGAAGATGAAGGTCATTTGGAC
TRN  10010101100011000
NAM  Q9FYM5_ARATH/182-292
ASQ  ANLAEGTAPPASYVINEKPYNMSYYL-ADGIYPKWSTLVQTIHDPRGPKKKLFAMKQEACRKDVERAFGVLQSRFAIVAGPSRLWNKTVLHDIMTSCIIMHNMIIEDERDID
DSQ  GCTAATCTAGCCGAAGGTACTGCTCCACCCGCTAGTTATGTTATCAATGAAAAACCCTATAATATGAGTTATTATTTA---GCTGATGGTATATATCCAAAGTGGTCCACTCTTGTTCAAACAATTCATGATCCACGTGGTCCCAAAAAGAAATTATTTGCCATGAAACAAGAAGCTTGTAGAAAAGATGTGGAACGTGCATTCGGAGTTTTGCAGTCGAGGTTTGCAATCGTGGCGGGGCCATCACGCTTATGGAATAAAACAGTATTACATGATATAATGACATCTTGTATCATAATGCATAATATGATCATCGAAGATGAGCGTGATATTGAT
TRN  10010101110011000
NAM  Q9LDY0_ARATH/255-365
ASQ  DDILQGRAPNVKYKVNGREYHLAYYL-TDGIYPKWATFIQSIRLPQNRKATLFATHQEADRKDVERAFGVLQARFHIIKNPALVWDKEKIGNIMKACIILHNMIVEDERDGY
DSQ  GATGATATATTACAAGGTCGAGCCCCAAATGTGAAGTACAAAGTCAATGGACGAGAGTATCATTTAGCTTACTATCTC---ACAGATGGTATTTATCCAAAATGGGCGACTTTTATCCAATCTATTCGACTACCACAAAATCGGAAAGCCACTTTATTTGCAACACATCAAGAAGCGGACCGTAAAGATGTCGAACGTGCATTTGGAGTATTGCAAGCTCGCTTTCACATTATTAAAAATCCAGCTCTTGTTTGGGATAAGGAAAAAATTGGAAATATTATGAAAGCATGTATCATACTGCACAATATGATAGTCGAAGACGAACGAGATGGGTAC
TRN  10010101100011010
NAM  Q9LHR9_ARATH/6-114
ASQ  WTSRSSSESEIR--SQREDYNLAYYL-TDGIYPKWFTFIQSISIPQGDKASLFAITQEACRKDVERAFGVLQARFAIVKHPALFHDKVKIRNIMRAYIILHNMIVEDERDGY
DSQ  TGGACCTCCAGGTCGAGCTCCGAAAGTGAAATACGT------AGTCAACGAGAAGACTATAATTTGGCTTACTACCTC---ACAGATGGAATTTATCCTAAATGGTTTACATTTATCCAATCAATTTCAATTCCACAAGGTGATAAAGCTTCTTTATTTGCTATAACTCAAGAAGCTTGTCGTAAAGATGTTGAGCGTGCTTTTGGAGTTTTGCAAGCTCGGTTTGCCATTGTCAAACATCCAGCTCTTTTTCATGATAAGGTGAAAATTAGAAATATTATGCGAGCATATATAATACTTCACAATATGATAGTAGAAGACGAACGAGATGGGTAC
TRN  10010101110011000
NAM  Q9C845_ARATH/155-266
ASQ  IGSIDCMHWEWKNCPTAWKGQYTRGSGKPTIVLEAATFIQSISILQGNKASLFATTQEACRKDVERAFGVLQARFAIIKHPALFHDKVKIGNIMRACIILHNMIVEDKRDGY
DSQ  ATAGGAAGCATCGACTGTATGCATTGGGAGTGGAAAAATTGTCCCACCGCTTGGAAAGGACAATATACACGTGGATCAGGAAAACCAACAATCGTTTTAGAGGCCGCTACATTTATCCAATCAATTTCAATTCTACAAGGTAATAAAGCTTCTTTATTTGCTACAACTCAAGAAGCTTGTCGTAAAGATGTTGAGCGTGCTTTCGGAGTTTTGCAAGCTCGGTTTGCCATTATCAAACATCCAGCTCTTTTTCATGATAAGGTGAAAATTGGCAATATTATGCGAGCATGTATAATACTTCACAATATGATAGTAGAGGACAAACGAGATGGTTAC
TRN  10010101110011000
NAM  Q9ST09_BRACM/10-121
ASQ  VRVVHNSLFLVLNVLNLQVWVKTDHLREKKERNGTATFIQSIQIPQGPKAVLFAQCQEAARKDVERAFGVLQARFAIVKNPALFWDKVKIGNIMRVCIILHNMIVEDERDGY
DSQ  GTGAGAGTAGTTCACAACTCCCTGTTTTTAGTACTCAATGTACTGAACCTTCAAGTTTGGGTGAAGACAGACCATCTGAGAGAAAAGAAAGAAAGAAATGGAACGGCAACTTTTATCCAATCTATTCAAATACCACAAGGCCCGAAAGCAGTTTTATTTGCTCAGTGTCAAGAAGCTGCCCGAAAAGATGTCGAGCGTGCTTTTGGAGTCTTGCAAGCTCGTTTTGCCATTGTTAAGAATCCGGCACTTTTTTGGGACAAAGTCAAAATTGGGAATATTATGAGAGTGTGTATCATACTCCATAATATGATTGTAGAAGACGAAAGAGATGGATAC
TRN  10010101100011010
//