EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04826 - DUF634)
FAM  PF04826
PID  DUF634
DES  Protein of unknown function (DUF634)
IPR  IPR006911
ANO  7
ALN  264
AID  0.415679
APH  (((Q9D0L7_MOUSE/38-300:0.12882,Q9BTM6_HUMAN/40-302:0.11350):0.29295,(Q9UH62_HUMAN/100-363:0.34456,(Q9CXI9_MOUSE/517-778:0.40876,Q9CX83_MOUSE/187-450:0.29260):0.08120):0.08557):0.48078,Q9BE11_MACFA/302-544:0.73710,Q9H969_HUMAN/289-552:0.59637);
ATP  (((Q9D0L7_MOUSE/38-300,Q9BTM6_HUMAN/40-302),(Q9UH62_HUMAN/100-363,(Q9CXI9_MOUSE/517-778,Q9CX83_MOUSE/187-450))),Q9BE11_MACFA/302-544,Q9H969_HUMAN/289-552);
ATL  3.59233
DNO  7
DLN  792
DID  0.579247
DPH  (((Q9UH62_HUMAN/100-363:0.20982,(Q9CXI9_MOUSE/517-778:0.24882,Q9CX83_MOUSE/187-450:0.25096):0.06745):0.04762,(Q9BE11_MACFA/302-544:0.40555,Q9H969_HUMAN/289-552:0.33007):0.15039):0.21949,Q9D0L7_MOUSE/38-300:0.14414,Q9BTM6_HUMAN/40-302:0.06854);
DTP  (((Q9UH62_HUMAN/100-363,(Q9CXI9_MOUSE/517-778,Q9CX83_MOUSE/187-450)),(Q9BE11_MACFA/302-544,Q9H969_HUMAN/289-552)),Q9D0L7_MOUSE/38-300,Q9BTM6_HUMAN/40-302);
DTL  2.14285
RID  0.415679
RPH  (((Q9D0L7_MOUSE/38-300:0.12882,Q9BTM6_HUMAN/40-302:0.11350):0.29295,(Q9UH62_HUMAN/100-363:0.34456,(Q9CXI9_MOUSE/517-778:0.40876,Q9CX83_MOUSE/187-450:0.29260):0.08120):0.08557):0.48078,Q9BE11_MACFA/302-544:0.73710,Q9H969_HUMAN/289-552:0.59637);
RTP  (((Q9D0L7_MOUSE/38-300,Q9BTM6_HUMAN/40-302),(Q9UH62_HUMAN/100-363,(Q9CXI9_MOUSE/517-778,Q9CX83_MOUSE/187-450))),Q9BE11_MACFA/302-544,Q9H969_HUMAN/289-552);
RTL  3.59233
LNK  Q9BE11_MACFA/302-544:Q9BE11:AB060242
LNK  Q9BTM6_HUMAN/40-302:Q9BTM6:BC003586
LNK  Q9CX83_MOUSE/187-450:Q9CX83:AK019405
LNK  Q9CXI9_MOUSE/517-778:Q9CXI9:AK014329
LNK  Q9D0L7_MOUSE/38-300:Q9D0L7:AK011303
LNK  Q9H969_HUMAN/289-552:Q9H969:AK023031
LNK  Q9UH62_HUMAN/100-363:Q9UH62:AF211175
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9H969_HUMAN/289-552
ASQ  EKYGPNPKACHCKSRGFSLEPKEFDKLVALLKLTKDPFIHEIATMIMGVSPAYPFTQDIIHDVGITVMIENLVNNPNVKEHPGALSMVDDSSESSEEPKSGESYIHQVCKGIISCPLNSPVQLAGLKLLGHLSIKFEDHYVITSYIPDFLTLLNKGSVKTKFYVLKVFSCLSKNHANTRELISAKVLSSLVAPFNKNESKANILNIIEIFENINFQFKTKAKLFTKEKFTKSELISIFQEAKQFGQKLQDLAEHSDPEVRDKVI
DSQ  GAAAAGTATGGGCCTAATCCGAAGGCCTGCCACTGCAAATCACGTGGCTTTAGTTTAGAGCCTAAAGAGTTTGATAAACTTGTTGCCCTCCTTAAGTTAACTAAGGATCCTTTCATTCATGAAATAGCTACAATGATAATGGGCGTCAGTCCTGCTTATCCATTTACTCAAGATATAATTCATGATGTAGGTATTACTGTTATGATTGAAAACTTGGTCAATAATCCCAATGTTAAAGAACACCCTGGAGCTTTAAGTATGGTGGATGACAGCTCTGAGTCTTCCGAAGAACCAAAATCAGGGGAGTCATATATACATCAAGTTTGTAAAGGCATAATCTCTTGCCCCTTGAACTCCCCTGTGCAGCTGGCTGGACTGAAATTACTAGGGCACTTGAGTATAAAATTTGAAGATCACTATGTGATTACCAGTTATATTCCAGATTTCCTCACCTTGTTAAACAAGGGAAGTGTCAAAACCAAGTTTTATGTTTTAAAAGTGTTTTCGTGTTTGTCTAAAAATCACGCCAATACAAGAGAATTGATCAGTGCCAAAGTACTGTCATCATTGGTTGCACCCTTTAACAAGAATGAGTCAAAGGCCAATATTCTTAATATTATTGAAATATTTGAGAATATAAATTTTCAGTTCAAAACAAAGGCAAAGCTATTTACCAAGGAAAAGTTCACTAAATCTGAGCTTATTTCAATATTCCAGGAAGCAAAACAGTTTGGTCAGAAACTCCAAGACTTAGCAGAGCACAGTGATCCCGAAGTGAGAGATAAAGTCATA
TRN  10010101100011000
NAM  Q9BE11_MACFA/302-544
ASQ  REVNGIKPFACPCKMECYMDSEEFEKLVNLLKSTTDPLIHKIARIAMGVHNVHPFAQEFINEVGVVTLIESLLSFPSPEMRKKTVITLNPPSGD-ERQRKIELHVKHMCKETVSFPLNSPGQQSGLKILGQLTTDFVHHYIVANYFSELFHLLSSGNCKTRNLVLKLLLNMSENPTAARDMINMKALAALKLIFNQKEAKANLVSGVAIFINIKEHIR------------KGSIVVVDHLSY---NTLMAIFR----EVKG-II
DSQ  AGGGAGGTAAATGGGATTAAGCCATTTGCTTGTCCTTGCAAAATGGAATGCTATATGGATTCTGAGGAATTTGAGAAACTTGTTAACTTACTTAAGTCAACTACTGATCCTCTTATTCATAAAATAGCACGGATTGCAATGGGTGTCCATAATGTTCACCCGTTTGCCCAAGAGTTTATTAATGAAGTGGGTGTAGTGACACTTATTGAAAGCTTGCTCAGTTTTCCTTCCCCTGAAATGAGAAAAAAGACTGTAATTACTCTGAATCCTCCTTCTGGGGAT---GAAAGACAACGCAAAATTGAATTACATGTTAAGCATATGTGTAAAGAAACCGTGTCATTTCCTTTGAACTCACCCGGACAGCAATCTGGATTAAAGATACTAGGACAACTGACTACTGATTTTGTCCATCACTACATTGTTGCCAATTACTTTTCAGAGCTTTTCCATTTGCTGTCCTCAGGAAATTGCAAAACCAGAAATCTTGTTCTGAAACTGCTTTTAAATATGTCTGAAAATCCAACTGCAGCCAGAGACATGATCAATATGAAGGCATTGGCAGCATTAAAACTCATCTTTAACCAGAAAGAGGCAAAAGCCAATCTTGTTAGTGGTGTGGCCATATTTATTAACATAAAGGAGCATATCAGA------------------------------------AAAGGCTCAATTGTAGTTGTTGATCACTTGAGTTAT---------AATACACTCATGGCCATTTTCAGG------------GAAGTTAAAGGG---ATTATT
TRN  10010101100011000
NAM  Q9BTM6_HUMAN/40-302
ASQ  IRSSKSAEDLTDGSYDDVLNAEQLQKLLYLLESTEDPVIIERALITLGNNAAFSVNQAIIRELGGIPIVANKINHSNQSIKEKALNALNNLSVNVENQIKIKIYISQVCEDVFSGSLNSAVQLAGLTLLTNMTVTNDHQHMLHSYITDLFQVLLTGNGNTKVQVLKLLLNLSENPAMTEGLLRAQVDSSFLSLYDSHVAKEILLRVLTLFQNIKNCLKIEGHLAVQPTFTEGSLFFLLH-GEECAQKIRALVDHHDAEVKEKVV
DSQ  ATACGCTCTTCGAAGTCCGCAGAAGACTTAACTGATGGTTCATATGATGATGTTCTAAATGCTGAACAACTTCAGAAACTCCTTTACCTGCTGGAGTCAACGGAGGATCCTGTAATTATTGAAAGAGCTTTGATTACTTTGGGTAACAATGCAGCCTTTTCAGTTAACCAAGCTATTATTCGTGAATTGGGTGGTATTCCAATTGTTGCAAACAAAATCAACCATTCCAACCAGAGTATTAAAGAGAAAGCTTTAAATGCACTAAATAACCTGAGTGTGAATGTTGAAAATCAAATCAAGATAAAGATATACATCAGTCAAGTATGTGAGGATGTCTTCTCTGGTTCTCTGAACTCTGCTGTGCAGCTGGCTGGACTGACATTGTTGACAAACATGACTGTTACCAATGACCACCAGCACATGCTTCACAGTTACATTACAGACCTGTTCCAGGTGTTACTTACTGGAAATGGAAACACGAAGGTGCAAGTTTTGAAACTGCTTTTGAATTTGTCTGAAAATCCAGCCATGACAGAAGGACTTCTCCGTGCCCAAGTGGATTCATCATTCCTTTCCCTTTATGACAGCCACGTAGCAAAGGAGATTCTTCTTCGAGTACTTACGCTATTTCAGAATATAAAGAACTGCCTCAAAATAGAAGGCCATTTAGCTGTGCAGCCTACTTTCACTGAAGGTTCATTGTTTTTCCTGTTACAT---GGAGAAGAATGTGCCCAGAAAATAAGAGCTTTAGTTGATCACCATGATGCAGAGGTGAAGGAAAAGGTTGTA
TRN  10010101100011000
NAM  Q9D0L7_MOUSE/38-300
ASQ  LRPSRSAEDLTDGSYDDILNAEQLKKLLYLLESTDDPVITEKALVTLGNNAAFSTNQAIIRELGGIPIVGNKINSLNQSIKEKALNALNNLSVNVENQTKIKIYVPQVCEDVFADPLNSAVQLAGLRLLTNMTVTNDYQHLLSGSVAGLFHLLLLGNGSTKVQVLKLLLNLSENPAMTEGLLSVQVDSSFLSLYDGQVANEILLRALTLFQNINNCLKVEGRLANQIPFAKGSLFFLLY-GEECAQKMRALACHHDVDVKEKAL
DSQ  CTGCGCCCTTCGCGATCCGCAGAAGACCTAACCGATGGCTCCTATGACGATATCTTAAATGCAGAGCAGCTTAAGAAACTTCTGTATCTGCTGGAGTCAACCGACGATCCTGTCATTACTGAAAAGGCCTTGGTCACCTTGGGAAATAATGCAGCCTTCTCCACTAACCAGGCCATTATTCGTGAGTTGGGTGGTATCCCAATTGTTGGAAACAAAATCAACTCCCTGAACCAAAGTATTAAAGAGAAAGCTTTAAATGCACTGAATAACCTGAGTGTGAATGTTGAAAATCAAACTAAGATAAAGATATACGTCCCTCAAGTCTGTGAGGACGTCTTTGCTGACCCCCTGAACTCTGCGGTGCAGCTGGCCGGACTGAGGCTGCTGACAAACATGACGGTCACCAACGACTATCAGCACCTGCTCAGCGGCTCCGTCGCTGGCCTGTTCCACCTGCTGCTGCTGGGAAACGGAAGCACCAAGGTCCAGGTTTTGAAGCTGCTTTTGAATTTGTCTGAGAATCCAGCCATGACAGAAGGACTACTGAGTGTCCAAGTGGATTCTTCATTCCTTTCCCTTTATGACGGCCAAGTAGCAAATGAGATTCTTCTTCGGGCTCTTACACTGTTTCAGAATATAAACAACTGCCTCAAAGTGGAAGGCCGGTTAGCTAATCAGATTCCTTTTGCTAAAGGGTCATTGTTTTTTCTGTTATAC---GGAGAAGAATGTGCCCAGAAAATGAGAGCTTTAGCCTGTCATCATGATGTGGATGTGAAAGAGAAAGCTTTA
TRN  10010101100011000
NAM  Q9UH62_HUMAN/100-363
ASQ  RARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDDTITSRLNSSVQLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVG
DSQ  CGGGCACGTCGGGCTGTCCAGAAACGGGCTTCCCCCAATTCAGATGATACCGTTTTGTCCCCTCAAGAGCTACAAAAGGTTCTTTGCTTGGTTGAGATGTCTGAAAAGCCTTATATTCTTGAAGCAGCTTTAATTGCTCTGGGTAACAATGCTGCTTATGCATTTAACAGAGATATTATTCGTGATCTGGGTGGTCTCCCAATTGTCGCAAAGATTCTCAATACTCGGGATCCCATAGTTAAGGAAAAGGCTTTAATTGTCCTGAATAACTTGAGTGTGAATGCTGAAAATCAGCGCAGGCTTAAAGTATACATGAATCAAGTGTGTGATGACACAATCACTTCTCGCTTGAACTCATCTGTGCAGCTTGCTGGACTGAGATTGCTTACAAATATGACTGTTACTAATGAGTATCAGCACATGCTTGCTAATTCCATTTCTGACTTTTTTCGTTTATTTTCAGCGGGAAATGAAGAAACCAAACTTCAGGTTCTGAAACTCCTTTTGAATTTGGCTGAAAATCCAGCCATGACTAGGGAACTGCTCAGGGCCCAAGTACCATCTTCACTGGGCTCCCTCTTTAATAAGAAGGAGAACAAAGAAGTTATTCTTAAACTTCTGGTCATATTTGAGAACATAAATGATAATTTCAAATGGGAAGAAAATGAACCTACTCAGAATCAATTCGGTGAAGGTTCACTTTTTTTCTTTTTAAAAGAATTTCAAGTGTGTGCTGATAAGGTTCTGGGAATAGAAAGTCACCATGATTTTTTGGTGAAAGTAAAAGTTGGA
TRN  10010101100011000
NAM  Q9CX83_MOUSE/187-450
ASQ  AWPVRKGKFSFPYKIDDILSAPDLQKVLNILERTNDPFTQEVALVTLGNNAAYSFNQNAIRELGGVPIIAKLIKTRDPIIREKTYNALNNLSVNSENQGKIKTYISQVCDDTMVCRLDSAVQMAGLRLLTNMTVTNHYQHLLSYSFPDFFALLFLGNHFTKIQTMKLIINFTENPAMTRELVSCKVPSELISLFNKEWDREILLNILTLFENINDNIKSEGLASSRKEFSRSSLFFLFKESGVCVKKIKALASHKDLVVKVKVL
DSQ  GCATGGCCTGTACGCAAGGGCAAGTTCAGCTTTCCCTATAAAATTGATGATATTCTGAGCGCCCCTGATCTTCAAAAGGTCCTGAACATCCTGGAGAGAACAAATGACCCTTTTACTCAGGAAGTAGCACTGGTCACACTGGGTAACAATGCAGCATATTCATTTAATCAAAACGCCATCCGTGAGCTGGGTGGAGTCCCCATTATTGCAAAGCTGATAAAAACAAGAGACCCCATTATTAGGGAAAAGACTTACAATGCTCTTAATAACTTGAGCGTTAATTCTGAGAATCAGGGCAAGATTAAGACTTATATCAGTCAAGTGTGTGACGATACCATGGTTTGCCGCTTGGACTCAGCCGTCCAGATGGCTGGATTAAGACTCCTTACCAACATGACTGTAACTAATCACTACCAACATTTGCTTTCCTATTCTTTCCCAGATTTCTTTGCTTTGTTATTCCTGGGAAACCACTTCACCAAGATACAGACTATGAAACTGATTATAAATTTTACTGAAAACCCAGCCATGACAAGAGAGCTGGTCAGTTGTAAAGTACCTTCGGAATTGATTTCTCTGTTTAATAAAGAATGGGATAGAGAGATTCTTCTTAACATTCTTACCCTCTTTGAAAATATAAACGATAACATAAAAAGTGAAGGGCTTGCATCCTCCAGGAAGGAATTCAGCAGGAGCTCACTGTTTTTCTTATTTAAAGAGTCTGGAGTATGTGTGAAGAAAATCAAAGCATTAGCAAGCCATAAGGATCTGGTGGTCAAAGTGAAAGTTCTA
TRN  10010101100011000
NAM  Q9CXI9_MOUSE/517-778
ASQ  KRTIPMHKRPFPYEIDEILGVRDLRKVLALLQKSDDPFIQQVALLTLSNNANYSCNQETIRKLGGLPIIANMINKTDPHIKEKALMAMNNLSENYENQGRLQVYMNKVMDDIMASNLNSAVQVVGLKFLTNMTITNDYQHLLVNSIANFFRLLSQGGGKIKVEILKILSNFAENPDMLKKLLGTQVPSSFSSLYNSYVESEILINALTLFEIIFDNLRAE--VFNYREFNKGSLFYLCTTSGVCVKKIRALANHHDLLVKVKVI
DSQ  AAGAGAACCATTCCCATGCATAAGCGCCCCTTTCCATATGAAATTGATGAGATCCTAGGTGTTCGAGATCTCAGGAAAGTCCTAGCCTTGCTTCAGAAGTCAGATGATCCCTTCATTCAGCAAGTAGCCCTGCTCACCCTGAGCAACAATGCCAATTATTCATGTAATCAAGAAACAATCCGAAAGTTGGGAGGCCTCCCAATTATTGCAAACATGATCAACAAAACTGACCCCCACATTAAGGAAAAAGCCTTAATGGCCATGAATAACCTGAGTGAAAATTATGAAAACCAGGGCAGACTTCAGGTGTACATGAATAAAGTGATGGATGATATTATGGCTTCTAACCTGAACTCAGCGGTACAGGTAGTTGGGCTAAAATTTTTAACAAACATGACTATTACTAATGACTACCAGCACCTGCTTGTCAATTCCATTGCCAACTTTTTCCGCTTGTTATCTCAGGGGGGTGGAAAAATCAAGGTTGAGATTCTGAAAATACTTTCAAACTTTGCTGAAAATCCGGACATGCTAAAGAAACTTCTCGGTACCCAGGTGCCGTCATCATTTAGTTCCCTTTATAATTCTTATGTGGAATCAGAAATTCTTATTAATGCCCTTACTCTATTTGAGATTATCTTCGACAACCTCAGAGCAGAA------GTGTTCAACTACAGGGAATTCAACAAGGGGTCCCTGTTTTACTTATGCACTACATCTGGGGTGTGTGTGAAGAAAATTCGAGCCTTAGCAAATCACCACGACCTCTTGGTGAAAGTGAAAGTTATA
TRN  10010101100011000
//