EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04808 - CTV_P23)
FAM  PF04808
PID  CTV_P23
DES  Citrus tristeza virus (CTV) P23 protein
IPR  IPR006893
ANO  3
ALN  209
AID  0.900534
APH  (Q9DJS8_9CLOS/1-209:0.07869,Q66245_9CLOS/1-209:0.05631,Q66258_9CLOS/1-209:0.05082);
ATP  (Q9DJS8_9CLOS/1-209,Q66245_9CLOS/1-209,Q66258_9CLOS/1-209);
ATL  0.18582
DNO  3
DLN  627
DID  0.899522
DPH  (Q9DJS8_9CLOS/1-209:0.07070,Q66245_9CLOS/1-209:0.05441,Q66258_9CLOS/1-209:0.04044);
DTP  (Q9DJS8_9CLOS/1-209,Q66245_9CLOS/1-209,Q66258_9CLOS/1-209);
DTL  0.16555
RID  0.900534
RPH  (Q9DJS8_9CLOS/1-209:0.07869,Q66245_9CLOS/1-209:0.05631,Q66258_9CLOS/1-209:0.05082);
RTP  (Q9DJS8_9CLOS/1-209,Q66245_9CLOS/1-209,Q66258_9CLOS/1-209);
RTL  0.18582
LNK  Q66245_9CLOS/1-209:Q66245:U16304
LNK  Q66258_9CLOS/1-209:Q66258:U42022
LNK  Q9DJS8_9CLOS/1-209:Q9DJS8:AJ298843
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9DJS8_9CLOS/1-209
ASQ  MNDTSGQTFVSVNLSDESNTASTRVENVKSEADRLEFLRKMNPLIIDALVRKTNYQGARFRARIIGVCVDCGRKHDKALKTERKCKVNNTQSQNEVAHMLMHDPVKYLNKRKARAFSNAEMFAIELVLYTKEKQLAVDLAAEREKTRLARRHPMRSPEETPEHYKFGMTASAMLPELNAVGVGDNEDTSSEYPVSLSVSGGVLREHHFI
DSQ  ATGAACGATACTAGCGGACAAACTTTCGTTTCTGTGAACCTTTCTGACGAAAGCAACACAGCGAGCACTAGAGTTGAAAACGTAAAATCGGAAGCGGATCGCTTGGAGTTTTTACGTAAAATGAATCCCTTAATTATTGACGCTCTGGTGCGGAAAACCAATTATCAGGGCGCTCGCTTTCGTGCGAGAATAATAGGAGTATGCGTGGATTGTGGTAGAAAACACGACAAGGCGCTCAAGACTGAACGTAAGTGTAAGGTCAACAATACGCAGTCTCAGAACGAGGTGGCGCATATGTTGATGCACGATCCCGTTAAATATTTAAACAAAAGAAAGGCTAGAGCCTTTTCTAACGCAGAGATGTTTGCGATTGAATTGGTTTTGTACACCAAGGAAAAGCAATTGGCGGTTGATTTGGCCGCCGAAAGGGAGAAGACGAGGTTGGCTCGTAGACACCCAATGCGTTCTCCAGAGGAAACTCCGGAACATTATAAATTCGGTATGACCGCTTCAGCGATGTTACCGGAACTCAACGCTGTAGGCGTTGGTGATAACGAAGACACTTCGTCGGAGTACCCAGTAAGTCTGAGTGTTTCCGGTGGAGTTCTCCGTGAACACCACTTCATC
TRN  10010101100011000
NAM  Q66245_9CLOS/1-209
ASQ  MDNTSGQTFVSVNLSDESNTATTDVEPVSSEADRLDFLQKMNPIIIDALIRKNSYQGARFRARIIGVCVDCGRKHDKGLKTERKCKVNNTQSQNEVAHMLMHDPVKYLNKRKARAFSNAEIFAIDLVMYTKERQLAIDLAAEREKTRLARRHPMRSPEETPEYYKFGRTAKAMLPDINAVDVGDNEETSSEYPVSLSVSGGVLREHHFI
DSQ  ATGGATAATACTAGCGGACAAACTTTCGTTTCTGTGAACCTTTCTGACGAAAGCAACACAGCGACCACTGACGTCGAACCCGTGAGTTCGGAAGCGGATCGCTTGGATTTTTTACAGAAAATGAATCCCATTATTATCGATGCTTTGATACGGAAGAATAGTTATCAGGGCGCTCGCTTTCGCGCGAGAATAATAGGAGTGTGCGTGGATTGCGGTAGAAAACACGATAAGGGGTTGAAGACTGAACGTAAGTGTAAGGTCAACAATACGCAGTCTCAGAACGAGGTGGCGCATATGTTAATGCACGACCCCGTTAAGTATTTAAACAAAAGAAAAGCTAGAGCCTTTTCTAATGCGGAGATATTTGCGATTGATTTGGTTATGTACACCAAGGAAAGGCAATTGGCTATTGATTTGGCCGCTGAAAGGGAGAAAACGAGACTGGCTCGTAGACACCCGATGCGTTCTCCGGAAGAAACTCCGGAATATTATAAATTCGGTAGGACTGCTAAAGCAATGTTACCGGACATCAACGCCGTAGACGTTGGTGATAACGAGGAAACTTCGTCGGAGTATCCAGTGAGTCTGAGTGTTTCTGGCGGAGTTCTCCGCGAACACCACTTCATC
TRN  10010101100011010
NAM  Q66258_9CLOS/1-209
ASQ  MDNPSGQTFISVNLSDESNTASTETKAVSSEADRLEFLRKMNPFIIDALIRKNSYQGARFRARIIGVCVDCGRKHDKASRTERKCKVNNTQSQNEVAHMLMHDPVKYLNKRKARAFSNAEMFAIDLVMHTKERQLAVDLAAEREKTRLARRHPMRSPEETPEHYKFGMTAKAMLPNINAVDVGDNEDTSSEYPVSLSVSGGVLREHHLI
DSQ  ATGGATAATCCTAGCGGACAAACTTTTATTTCTGTGAACCTTTCTGACGAAAGCAACACAGCTAGTACTGAAACCAAAGCCGTAAGTTCGGAAGCGGATCGCTTGGAATTTTTACGGAAAATGAATCCCTTCATTATCGACGCTTTGATACGGAAAAACAGTTATCAAGGCGCTCGCTTTCGCGCGAGAATAATAGGAGTGTGCGTGGATTGTGGTAGAAAACACGATAAGGCATCGAGGACTGAACGTAAGTGTAAGGTCAACAATACGCAGTCTCAGAACGAGGTGGCGCATATGTTGATGCACGATCCCGTAAAATATTTAAATAAAAGAAAAGCTAGAGCCTTTTCTAACGCAGAGATGTTTGCGATCGATTTGGTTATGCACACCAAAGAAAGGCAATTAGCGGTTGATTTGGCCGCTGAAAGGGAGAAGACGAGATTGGCTCGTAGACACCCGATGCGTTCTCCGGAAGAGACTCCGGAACATTATAAATTCGGTATGACTGCTAAGGCAATGTTACCGAACATCAACGCTGTAGACGTTGGTGATAACGAAGACACCTCGTCGGAGTACCCAGTAAGTCTGAGTGTTTCCGGCGGAGTTCTCCGTGAACACCACTTGATC
TRN  10010101100011010
//