EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04741 - InvH)
FAM  PF04741
PID  InvH
DES  InvH outer membrane lipoprotein
IPR  IPR006830
ANO  3
ALN  147
AID  0.854015
APH  (P97075_9ENTR/1-147:0.09875,P97079_9ENTR/1-147:0.08301,INVH_SALCH/1-147:0.09223);
ATP  (P97075_9ENTR/1-147,P97079_9ENTR/1-147,INVH_SALCH/1-147);
ATL  0.27399
DNO  3
DLN  441
DID  0.876039
DPH  (P97075_9ENTR/1-147:0.05515,P97079_9ENTR/1-147:0.06249,INVH_SALCH/1-147:0.09337);
DTP  (P97075_9ENTR/1-147,P97079_9ENTR/1-147,INVH_SALCH/1-147);
DTL  0.21101
RID  0.854015
RPH  (P97075_9ENTR/1-147:0.09875,P97079_9ENTR/1-147:0.08301,INVH_SALCH/1-147:0.09223);
RTP  (P97075_9ENTR/1-147,P97079_9ENTR/1-147,INVH_SALCH/1-147);
RTL  0.27399
LNK  INVH_SALCH/1-147:P37422:Z17243
LNK  P97075_9ENTR/1-147:P97075:U84278
LNK  P97079_9ENTR/1-147:P97079:U84282
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  P97075_9ENTR/1-147
ASQ  MKKFYSCLPVFLLIGCAQVPPPSSGSKPVQQPEVQKEQQANADSIDKCMSLPYVPSDLTENKTLSNQKSENSTSKNNTISSSVFCEKYRQTKEQAFTFFQEHPQYMRSKEDEEQLMTEFKKVLLESGSNNLSIYQTLLTAHKRLQAL
DSQ  ATGAAAAAATTTTATAGCTGTCTTCCTGTCTTTTTACTGATCGGCTGTGCCCAGGTACCACCCCCTTCCTCCGGAAGTAAGCCTGTACAACAGCCTGAAGTTCAAAAAGAGCAACAAGCCAATGCAGATAGTATTGATAAGTGTATGTCTCTTCCGTACGTACCATCAGACCTTACGGAGAATAAAACATTATCAAACCAAAAATCTGAAAATTCCACATCAAAAAATAATACCATCAGCTCAAGCGTTTTTTGCGAAAAATATAGACAAACCAAAGAGCAGGCATTCACCTTCTTTCAGGAGCATCCGCAATACATGCGTTCGAAAGAAGATGAAGAGCAGCTAATGACTGAATTTAAAAAAGTCCTGCTCGAATCCGGAAGTAATAATTTAAGCATATATCAGACTTTACTCACTGCCCATAAAAGACTGCAAGCCTTA
TRN  10010101100011000
NAM  P97079_9ENTR/1-147
ASQ  MNKFYSCLPIFLLVGCAQVSSPSSGSKPAQQTDAQKEQQASAKSIDECMSLPYVPSDLAKNKTLSNQNADNSASKNNTISSSIFCEKYKQTKEQAFTFFQEYPQYMRSKEDEEQLMAEFKKVLLESGSKNLSIYQTLLAAHKRLQAL
DSQ  ATGAATAAATTTTATAGCTGTCTTCCTATCTTTTTACTGGTCGGCTGTGCCCAGGTATCTTCTCCTTCCTCCGGAAGCAAGCCTGCACAACAGACAGATGCTCAAAAAGAGCAACAAGCCAGTGCAAAAAGTATTGATGAGTGTATGTCTCTGCCGTACGTACCATCAGACCTTGCGAAGAATAAAACATTATCAAACCAAAACGCTGATAATTCCGCATCAAAAAATAACACAATCAGCTCAAGCATTTTTTGCGAAAAATATAAACAAACCAAAGAGCAAGCATTCACCTTCTTTCAGGAATATCCACAATACATGCGTTCGAAAGAAGATGAAGAACAGTTAATGGCTGAATTTAAAAAAGTTCTACTCGAATCCGGAAGCAAAAATTTAAGCATCTATCAGACGCTACTTGCTGCCCATAAAAGGCTACAAGCCTTA
TRN  10010101100011000
NAM  INVH_SALCH/1-147
ASQ  MKKFYSCLPVFLLIGCAQVPLPSSVSKPVQQPGAQEEQLANANSIDECQSLPYVPSDLAKNKSLSNQNADNSASKNSAISSSIFCEKYKQTKEQALTFFQEHPQYMRSKEDEEQLMTEFKKVLLEPGSKNLSIYQTLLSAHERLQAL
DSQ  ATGAAAAAATTTTATAGCTGTCTTCCTGTCTTTTTACTGATCGGCTGTGCTCAGGTGCCCCTCCCTTCCTCCGTGAGCAAACCGGTACAGCAACCTGGCGCTCAGGAAGAGCAACTGGCCAACGCAAATAGTATTGATGAGTGTCAGTCTCTTCCGTATGTGCCGTCAGACCTTGCGAAGAATAAATCATTATCAAACCAGAACGCTGATAATTCCGCATCAAAAAATAGCGCAATCAGCTCAAGCATTTTTTGCGAAAAATATAAACAAACCAAAGAGCAGGCGCTCACCTTCTTCCAGGAACATCCACAATACATGCGTTCGAAAGAAGATGAAGAGCAACTCATGACCGAATTTAAAAAAGTTTTGCTTGAACCCGGAAGTAAGAATTTAAGCATATATCAGACGTTACTTTCTGCCCATGAAAGACTGCAAGCCTTA
TRN  10010101100011000
//