EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04737 - Lant_dehyd_N)
FAM  PF04737
PID  Lant_dehyd_N
DES  Lantibiotic dehydratase, N terminus
IPR  IPR006826
ANO  9
ALN  176
AID  0.264258
APH  ((((((Q9KYL1_STRCO/6-176:0.85760,Q9RK93_STRCO/10-174:1.03043):0.54927,EPIB_STAEP/7-161:0.65941):0.15156,(SPAB_BACSU/7-161:0.42580,Q9FDU8_STRPY/1-147:0.88767):0.21915):0.18609,NISB_LACLA/8-157:0.74794):0.11030,O68588_STRMU/6-157:0.83759):0.88702,Q54123_STAEP/3-160:0.32154,O54222_STAEP/3-162:0.40981);
ATP  ((((((Q9KYL1_STRCO/6-176,Q9RK93_STRCO/10-174),EPIB_STAEP/7-161),(SPAB_BACSU/7-161,Q9FDU8_STRPY/1-147)),NISB_LACLA/8-157),O68588_STRMU/6-157),Q54123_STAEP/3-160,O54222_STAEP/3-162);
ATL  8.28116
DNO  9
DLN  528
DID  0.394202
DPH  ((Q9FDU8_STRPY/1-147:0.40904,(((O54222_STAEP/3-162:0.27897,Q54123_STAEP/3-160:0.18324):0.33418,O68588_STRMU/6-157:0.61377):0.11498,NISB_LACLA/8-157:0.43648):0.09292):0.10386,(SPAB_BACSU/7-161:0.05209,(Q9RK93_STRCO/10-174:0.36281,Q9KYL1_STRCO/6-176:0.51052):0.98237):0.40815,EPIB_STAEP/7-161:0.54894);
DTP  ((Q9FDU8_STRPY/1-147,(((O54222_STAEP/3-162,Q54123_STAEP/3-160),O68588_STRMU/6-157),NISB_LACLA/8-157)),(SPAB_BACSU/7-161,(Q9RK93_STRCO/10-174,Q9KYL1_STRCO/6-176)),EPIB_STAEP/7-161);
DTL  5.43232
RID  0.264258
RPH  ((((((Q9KYL1_STRCO/6-176:0.85760,Q9RK93_STRCO/10-174:1.03043):0.54927,EPIB_STAEP/7-161:0.65941):0.15156,(SPAB_BACSU/7-161:0.42580,Q9FDU8_STRPY/1-147:0.88767):0.21915):0.18609,NISB_LACLA/8-157:0.74794):0.11030,O68588_STRMU/6-157:0.83759):0.88702,Q54123_STAEP/3-160:0.32154,O54222_STAEP/3-162:0.40981);
RTP  ((((((Q9KYL1_STRCO/6-176,Q9RK93_STRCO/10-174),EPIB_STAEP/7-161),(SPAB_BACSU/7-161,Q9FDU8_STRPY/1-147)),NISB_LACLA/8-157),O68588_STRMU/6-157),Q54123_STAEP/3-160,O54222_STAEP/3-162);
RTL  8.28116
LNK  EPIB_STAEP/7-161:P30195:X62386
LNK  NISB_LACLA/8-157:P20103:X68307
LNK  O54222_STAEP/3-162:O54222:Y14023
LNK  O68588_STRMU/6-157:O68588:AF051560
LNK  Q54123_STAEP/3-160:Q54123:Z49865
LNK  Q9FDU8_STRPY/1-147:Q9FDU8:AB030831
LNK  Q9KYL1_STRCO/6-176:Q9KYL1:AL939129
LNK  Q9RK93_STRCO/10-174:Q9RK93:AL939104
LNK  SPAB_BACSU/7-161:P39774:L24075
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  EPIB_STAEP/7-161
ASQ  PSNIY---------MVRTPIFSIELYNQFLKSD-------NIDYDLILQNDIFKESIMTTTYNLYQSIGKIDWE-----KDNKKTRNVKESLLKYLIRMSTRSTPYGMLSGVALGEFSENNNIKIKDSSFHKKDVKIDGQWLYKLVHYLESDYTYYKDSFVIWNQQNYIYNNRLYL
DSQ  CCATCGAATATATAT---------------------------ATGGTAAGAACTCCTATATTTTCAATTGAATTATATAATCAATTCTTAAAATCTGAC---------------------AATATAGATTATGACTTAATTTTACAAAACGATATTTTTAAAGAATCTATAATGACAACGACATATAATCTTTATCAAAGTATTGGCAAAATAGACTGGGAA---------------AAGGATAATAAAAAAACCAGAAATGTAAAAGAAAGTTTATTAAAATATCTCATAAGAATGAGTACTAGAAGTACACCATATGGAATGCTAAGCGGTGTAGCTTTAGGGGAATTTAGTGAAAATAATAATATTAAAATTAAGGACTCTTCGTTTCATAAAAAAGATGTAAAAATAGATGGGCAATGGTTATATAAATTAGTCCATTATTTAGAAAGCGATTACACATATTATAAAGACAGTTTTGTCATATGGAATCAACAAAATTATATTTATAACAATCGTTTATATTTA
TRN  10010101110011000
NAM  Q9FDU8_STRPY/1-147
ASQ  MYKVF------PTGMIRIPLQKQEFY--------------NKDYEDLINDKVFMEQLLVASPSLYDSVIDFDK------CNEKKKQNVKVSLNSYSKRAAFRTTPFGIFTAINTVDLTKGTTSNVQKVSF-IKKAVPDYSWIYSLVKSYEI--SNLEKLSLKINTAAFTQGDRYVL
DSQ  ATGTATAAGGTATTT------------------CCAACTGGTATGATTCGTATTCCATTGCAAAAACAAGAATTTTAT------------------------------------------AATAAAGACTATGAAGATTTAATAAATGATAAAGTTTTTATGGAACAACTTTTAGTTGCTAGTCCCAGTCTTTATGATAGTGTAATAGATTTTGATAAA------------------TGTAATGAAAAGAAAAAGCAAAATGTAAAAGTCTCATTAAATAGTTATTCTAAAAGAGCAGCGTTTAGAACTACTCCATTTGGTATCTTTACTGCTATTAATACAGTTGATTTGACAAAGGGAACCACTTCTAATGTACAAAAGGTTAGTTTT---ATTAAAAAAGCAGTCCCAGATTATTCATGGATATATTCTCTAGTAAAATCGTATGAAATA------AGTAACCTTGAAAAACTTTCATTAAAAATAAATACAGCGGCGTTTACTCAAGGTGACAGATATGTACTA
TRN  10010101110011000
NAM  SPAB_BACSU/7-161
ASQ  PTDYY---------MIRVPLVHQDLKNENSQDI-------DQLLHDLCNDSLFREQILVSSRTLYETIHTFLQA--PDKLKGKKKRNFQQAILKYATRRATRTTPFGLFSSVGIGSFSDKNHLSFNQHSF-YKKARVDLEWLYQLIRKLEN--EYTDRLSFTLNSACYIKGDRAYL
DSQ  CCTACAGATTATTAT---------------------------ATGATTCGGGTTCCTTTAGTACATCAAGACTTAAAAAATGAGAATTCTCAGGATATC---------------------GATCAGTTATTACATGACCTTTGCAACGATTCATTATTTCGGGAACAAATACTGGTATCTAGCAGGACACTATATGAAACAATACATACTTTCCTGCAAGCG------CCGGATAAATTAAAAGGGAAAAAAAAGCGCAACTTTCAACAGGCTATTTTGAAGTATGCAACAAGAAGAGCAACAAGAACCACACCTTTTGGCCTTTTTTCTTCAGTCGGTATAGGGTCGTTTTCTGATAAAAATCACTTATCTTTTAATCAACATTCATTT---TACAAAAAGGCTCGTGTTGATTTGGAGTGGCTCTACCAATTAATTAGAAAATTGGAAAAC------GAATACACCGACCGACTTTCTTTTACATTAAATTCCGCTTGTTATATTAAGGGTGACCGGGCTTACTTG
TRN  10010101100011000
NAM  NISB_LACLA/8-157
ASQ  AQP-F---------LVRNTILCPNDKRSFTEYT--------QVIETVSKNKVFLEQLLLANPKLYDVMQKYNAG----LLKKKRVKKLFESIYKYYKRSYLRSTPFGLFSETSIGVFSKSSQYKLMGKT--TKGIRLDTQWLIRLVHKMEV--DFSKKLSFTRNNANYKFGDRVFQ
DSQ  GCTCAACCG---TTT---------------------------TTAGTAAGAAATACAATTTTATGTCCAAACGATAAACGGAGTTTTACTGAATATACT------------------------CAAGTCATTGAGACTGTAAGTAAAAATAAAGTTTTTTTGGAACAGTTACTACTAGCTAATCCTAAACTCTATGATGTTATGCAGAAATATAATGCTGGT------------CTGTTAAAGAAGAAAAGGGTTAAAAAATTATTTGAATCTATTTACAAGTATTATAAGAGAAGTTATTTACGATCAACTCCATTTGGATTATTTAGTGAAACTTCAATTGGTGTTTTTTCGAAAAGTTCACAGTACAAGTTAATGGGAAAGACT------ACAAAGGGTATAAGATTGGATACTCAGTGGTTGATTCGCCTAGTTCATAAAATGGAAGTA------GATTTCTCAAAAAAGTTATCATTTACTAGAAATAATGCAAATTATAAGTTTGGAGATCGAGTTTTTCAA
TRN  10010101100011000
NAM  O68588_STRMU/6-157
ASQ  FQDYF---------MYRKPLGNFSNFFSITDTM--------DPIELLHSDPIFAEGVYLASSSLRAAINKLKNH----TASTKDKKNARETIFQYYARYNTRSTPFGLFSSIGVGAFSAYLKK--EKSRY-EKSINIDLFWAYKVADKLESMPEILNTLKVVANNALQKSDNFWLL
DSQ  TTTCAAGATTATTTT---------------------------ATGTACAGAAAACCATTAGGCAACTTTTCTAATTTTTTTAGTATAACTGATACGATG------------------------GATCCCATTGAGTTACTACATAGTGATCCGATATTTGCTGAAGGAGTATATTTGGCCTCTTCATCTCTTAGAGCAGCCATAAATAAACTTAAGAATCAT------------ACTGCGAGTACTAAGGATAAAAAGAATGCAAGAGAGACTATTTTTCAATACTATGCCCGTTATAACACGAGATCAACTCCGTTTGGCTTGTTTTCGTCCATCGGAGTAGGTGCTTTTTCGGCTTACCTTAAAAAA------GAAAAGTCTCGTTAT---GAAAAATCTATTAATATTGATCTTTTTTGGGCTTATAAAGTAGCAGATAAACTAGAAAGTATGCCTGAAATTTTAAATACTTTAAAAGTAGTTGCTAATAATGCTTTGCAAAAGTCAGATAATTTTTGGCTTTTG
TRN  10010101110011000
NAM  O54222_STAEP/3-162
ASQ  LFKWY---------MIREPILEINKLEDIQERRDNNEDKYLNKLIDFIFDNELALPLYHANSNLFNMINNYKRK----ELSKKKKKNLILSLYNYITRMIFRATPFGFMSSINIGSIKPNEMTVWNNDTQ-KYNLDLDNRVLYPLLKNLNK--DIKNKIYLRKNYYIYKDYTHYYI
DSQ  TTATTTAAGTGGTAT---------------------------ATGATAAGAGAACCTATTTTAGAAATAAATAAGCTAGAGGATATACAAGAACGACGAGACAACAATGAAGATAAATATCTCAATAAACTTATAGATTTTATTTTTGATAATGAATTGGCATTACCTTTATATCATGCGAATAGTAATCTGTTTAATATGATTAATAATTATAAAAGAAAA------------GAATTATCTAAAAAGAAAAAGAAAAACTTAATTTTAAGTTTGTATAATTATATAACACGAATGATTTTTAGAGCAACTCCATTCGGTTTTATGTCATCTATAAATATAGGTTCTATAAAACCCAATGAAATGACAGTATGGAATAATGACACTCAA---AAATATAATCTAGATTTAGATAACAGAGTACTGTATCCACTTTTAAAAAATTTAAATAAA------GACATTAAAAATAAAATATACCTAAGAAAAAATTATTATATATATAAAGATTACACACATTATTATATA
TRN  10010101100011000
NAM  Q54123_STAEP/3-160
ASQ  LFDWY---------MVREPILNINDLKIIKKNNLNDDEYLNMLITFIF-DKGLDVCLCHANIELFSIIKNYQNI----NLSKKKKKNLSLSLYNYITRMILRSTPFGFMSSINIKALDTTNPI-WNNYAK-KYNLEIDSRLLYPLINKLNI--VVKNELYLKKNSNVYEDTTHFYI
DSQ  TTGTTTGATTGGTAT---------------------------ATGGTTAGAGAACCAATTTTAAACATTAATGATTTAAAGATTATAAAAAAAAATAACCTTAATGATGATGAATACTTAAATATGCTTATAACCTTTATTTTT---GATAAAGGATTAGATGTGTGCTTATGCCATGCTAATATTGAACTTTTTAGCATTATAAAAAATTATCAAAATATA------------AATTTATCTAAAAAGAAGAAAAAAAATTTATCATTAAGTTTATACAATTATATTACACGTATGATTTTAAGATCTACACCATTTGGGTTTATGTCATCTATAAATATAAAAGCATTAGATACTACAAATCCAATA---TGGAACAATTATGCAAAA---AAATATAATTTAGAAATTGACTCAAGATTACTTTACCCGCTAATAAATAAATTAAATATA------GTTGTAAAAAATGAATTATATCTAAAAAAAAATTCTAATGTTTACGAAGATACAACTCATTTTTATATC
TRN  10010101110011000
NAM  Q9RK93_STRCO/10-174
ASQ  AAAVFEVREPVLVRMASRPRGAAPATVDAAEPV--------SGARQLAADPLLGQAVRVASGSLAHSLARLTTDEGASALGRKRTLSAARTLTRYARRAGARPTPFGLFAGVGTARFGSVAKA--GPGTG-EVAVRLDGAWLRRRVLAWLEEPSVRRRVDVVLNDLCFVRDGRLYL
DSQ  GCAGCAGCGGTCTTCGAGGTACGGGAGCCCGTACTGGTCCGGATGGCGAGCCGGCCGCGGGGAGCCGCTCCGGCCACGGTCGACGCGGCCGAGCCGGTC------------------------TCCGGAGCGCGGCAGCTCGCCGCCGATCCCCTGCTCGGCCAGGCGGTCCGGGTCGCCAGCGGCTCGCTGGCCCACAGCCTGGCCCGTCTGACCACCGACGAGGGCGCCTCCGCCCTGGGGCGCAAGCGGACCCTGAGCGCCGCGCGGACCCTGACCCGGTACGCTCGCCGCGCCGGGGCGCGCCCCACCCCGTTCGGCCTGTTCGCGGGTGTCGGCACAGCCCGGTTCGGTTCCGTGGCCAAGGCC------GGGCCGGGGACCGGT---GAGGTCGCGGTCCGGCTCGACGGGGCGTGGCTGCGCCGACGGGTACTGGCCTGGCTCGAGGAGCCCTCCGTCCGCCGGCGCGTGGACGTCGTACTCAACGACCTGTGTTTCGTGCGGGACGGGCGGCTGTATCTG
TRN  11011111101111111
NAM  Q9KYL1_STRCO/6-176
ASQ  DCPLYRCADTALVRAARSARLPLPAWPDLTDDTPDCEVRWQTWLRDVWSLSEAADSIEQASPLLAQQVQALCSV---ASPETRQLRRAVVSVMRYLLRMTGRATPNGLFAGIAPASFGERPGWSWGE--WHRPVIRADGDWIADLVARLEADPELLRHLHVMANNTILIRGDRLIM
DSQ  GACTGCCCGCTGTACCGGTGCGCGGATACTGCGCTGGTGCGCGCCGCCCGTTCCGCGAGGCTGCCGCTTCCCGCGTGGCCGGACCTCACCGACGACACCCCGGACTGTGAGGTGCGGTGGCAGACGTGGCTGCGCGACGTCTGGTCGCTTTCCGAGGCCGCCGACTCCATCGAGCAGGCCAGCCCTCTGCTCGCGCAGCAGGTTCAGGCCCTGTGCTCGGTG---------GCCAGCCCCGAGACCCGTCAGTTGCGCCGCGCAGTGGTGTCGGTCATGCGGTACCTGCTGCGTATGACGGGCCGGGCGACCCCGAACGGTCTGTTCGCCGGTATCGCGCCCGCCTCGTTCGGGGAACGACCGGGATGGTCCTGGGGTGAG------TGGCATCGACCCGTCATCCGTGCCGACGGCGACTGGATCGCGGACCTGGTCGCCCGTCTGGAAGCAGATCCTGAACTTCTGCGGCACCTGCATGTGATGGCCAACAACACCATCCTCATACGGGGCGATCGGCTGATCATG
TRN  10010101100011011
//