EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04736 - Eclosion)
FAM  PF04736
PID  Eclosion
DES  Eclosion hormone
IPR  IPR006825
ANO  2
ALN  62
AID  0.474576
APH  (ECLH_DROME/35-96:0.70390,ECLH_BOMMO/27-88:0.15075);
ATP  (ECLH_DROME/35-96,ECLH_BOMMO/27-88);
ATL  0.85465
DNO  2
DLN  186
DID  0.575269
DPH  (ECLH_DROME/35-96:0.37280,ECLH_BOMMO/27-88:0.27225);
DTP  (ECLH_DROME/35-96,ECLH_BOMMO/27-88);
DTL  0.64505
RID  0.474576
RPH  (ECLH_DROME/35-96:0.65890,ECLH_BOMMO/27-88:0.19575);
RTP  (ECLH_DROME/35-96,ECLH_BOMMO/27-88);
RTL  0.85464
LNK  ECLH_BOMMO/27-88:P25331:D10135
LNK  ECLH_DROME/35-96:Q07892:X72302
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  ECLH_DROME/35-96
ASQ  RFDSMGGIDFVQVCLNNCVQCKTMLGDYFQGQTCALSCLKFKGKAIPDCEDIASIAPFLNAL
DSQ  AGATTTGACTCCATGGGTGGCATTGATTTTGTTCAGGTGTGCCTTAACAACTGCGTCCAGTGCAAGACCATGCTGGGAGATTACTTCCAGGGGCAGACCTGTGCCCTTTCCTGCCTCAAGTTCAAGGGCAAAGCCATCCCGGACTGCGAGGATATAGCCTCCATAGCCCCGTTTCTGAATGCGCTC
TRN  10010101100011011
NAM  ECLH_BOMMO/27-88
ASQ  SPAIASSYDAMEICIENCAQCKKMFGPWFEGSLCAESCIKARGKDIPECESFASISPFLNKL
DSQ  AGCCCTGCCATCGCATCCAGCTACGACGCAATGGAAATTTGCATCGAGAACTGCGCGCAATGCAAAAAAATGTTCGGCCCTTGGTTCGAGGGATCCCTTTGCGCGGAGTCCTGCATCAAAGCCAGAGGCAAAGACATTCCGGAATGCGAAAGCTTCGCATCCATATCTCCATTCCTGAATAAGCTT
TRN  10010101100011011
//