EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF04729 - Anti-silence)
FAM  PF04729
PID  Anti-silence
DES  Anti-silencing protein, ASF1-like
IPR  IPR006818
ANO  7
ALN  162
AID  0.507426
APH  ((Q9V464_DROME/1-155:0.17267,Q9DAP7_MOUSE/1-155:0.18966):0.12563,Q9C9M6_ARATH/1-155:0.29488,((Q9N927_9TRYP/4-159:0.18658,Q9BJ46_LEIMA/3-158:0.25489):0.93565,(CIA1_SCHPO/1-161:0.28310,ASF1_YEAST/1-155:0.17492):0.07502):0.14903);
ATP  ((Q9V464_DROME/1-155,Q9DAP7_MOUSE/1-155),Q9C9M6_ARATH/1-155,((Q9N927_9TRYP/4-159,Q9BJ46_LEIMA/3-158),(CIA1_SCHPO/1-161,ASF1_YEAST/1-155)));
ATL  2.84203
DNO  7
DLN  486
DID  0.517669
DPH  (((((Q9V464_DROME/1-155:0.18092,Q9DAP7_MOUSE/1-155:0.20539):0.14438,Q9C9M6_ARATH/1-155:0.36750):0.14793,CIA1_SCHPO/1-161:0.28151):0.10304,ASF1_YEAST/1-155:0.17282):0.59013,Q9N927_9TRYP/4-159:0.15230,Q9BJ46_LEIMA/3-158:0.31816);
DTP  (((((Q9V464_DROME/1-155,Q9DAP7_MOUSE/1-155),Q9C9M6_ARATH/1-155),CIA1_SCHPO/1-161),ASF1_YEAST/1-155),Q9N927_9TRYP/4-159,Q9BJ46_LEIMA/3-158);
DTL  2.66408
RID  0.507426
RPH  ((Q9V464_DROME/1-155:0.17267,Q9DAP7_MOUSE/1-155:0.18966):0.12563,Q9C9M6_ARATH/1-155:0.29488,((Q9N927_9TRYP/4-159:0.18658,Q9BJ46_LEIMA/3-158:0.25489):0.93565,(CIA1_SCHPO/1-161:0.28310,ASF1_YEAST/1-155:0.17492):0.07502):0.14903);
RTP  ((Q9V464_DROME/1-155,Q9DAP7_MOUSE/1-155),Q9C9M6_ARATH/1-155,((Q9N927_9TRYP/4-159,Q9BJ46_LEIMA/3-158),(CIA1_SCHPO/1-161,ASF1_YEAST/1-155)));
RTL  2.84203
LNK  ASF1_YEAST/1-155:P32447:L07593
LNK  CIA1_SCHPO/1-161:O74515:AB031397
LNK  Q9BJ46_LEIMA/3-158:Q9BJ46:AF339905
LNK  Q9C9M6_ARATH/1-155:Q9C9M6:AC013288
LNK  Q9DAP7_MOUSE/1-155:Q9DAP7:AK005646
LNK  Q9N927_9TRYP/4-159:Q9N927:AL929604
LNK  Q9V464_DROME/1-155:Q9V464:AE003516
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.....xxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...............xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  ASF1_YEAST/1-155
ASQ  MSIVSLLGIKVL-NNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVFSADPPSAELIPA.SELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPA.....KVQVDHIVRNILAEKPRVTRFNIVWDN
DSQ  ATGTCAATTGTTTCACTGTTAGGCATCAAAGTCTTA---AACAACCCGGCAAAGTTCACTGATCCATATGAGTTTGAAATCACTTTTGAATGCTTAGAATCTTTAAAACATGACTTAGAGTGGAAACTAACCTATGTTGGGTCCTCTCGTTCTCTAGACCATGACCAGGAATTGGATTCCATTCTGGTAGGCCCCGTTCCCGTAGGTGTTAATAAATTTGTGTTTTCTGCTGACCCTCCCTCCGCCGAGCTGATTCCTGCG...AGTGAATTGGTTAGTGTGACTGTTATTCTATTAAGTTGTTCTTATGACGGGAGAGAGTTTGTTAGGGTCGGTTACTACGTGAATAATGAGTACGATGAAGAAGAGTTAAGAGAAAATCCGCCAGCA...............AAGGTACAAGTAGATCATATTGTAAGAAATATACTGGCTGAAAAGCCAAGGGTAACAAGGTTTAACATTGTTTGGGATAAT
TRN  10010101100011000
NAM  CIA1_SCHPO/1-161
ASQ  MSIVNILSVNVL-NNPAKFSDPYKFEITFECLEPLKSDLEWKLTYVGSATSQSYDQILDTLLVGPIPIGINKFVFEADPPNIDLLPQlSDVLGVTVILLSCAYEDNEFVRVGYYVNNEMEGLNLQEMDDAeikkvKVDISKVWRSILAEKPRVTRFNIQWDN
DSQ  ATGTCAATCGTGAATATCCTTAGTGTTAATGTGCTA---AATAATCCGGCAAAGTTCTCTGATCCATATAAATTCGAAATTACCTTTGAATGTCTGGAGCCGTTAAAAAGCGACCTGGAATGGAAGTTGACATATGTAGGTAGTGCGACGTCTCAAAGTTACGACCAAATTTTGGACACGCTACTAGTGGGACCTATACCAATCGGGATTAATAAATTCGTTTTTGAAGCTGATCCTCCTAATATCGATCTTTTACCTCAActcAGCGATGTTTTGGGTGTCACAGTTATTTTACTCTCTTGTGCATATGAGGATAATGAGTTTGTTCGAGTAGGTTATTATGTCAACAATGAGATGGAGGGCCTGAACCTTCAGGAAATGGACGATGCAgaaattaaaaaggtcAAGGTTGACATTTCTAAAGTCTGGCGCAGTATTTTAGCAGAAAAGCCAAGGGTGACTCGATTCAACATTCAGTGGGATAAT
TRN  10010101100011000
NAM  Q9DAP7_MOUSE/1-155
ASQ  MAKVSVLNVAVL-ENPSPFHSPFRFEISFECSEALSDDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPE.TDAVGVTVVLITCTYHGQEFIRVGYYVNNEYPDPELRENPPP.....KPDFSQLQRNILASNPRVTRFHINWDN
DSQ  ATGGCCAAGGTGTCGGTGCTGAATGTGGCTGTGCTG---GAGAACCCGAGCCCTTTCCACAGCCCCTTCCGGTTCGAGATCAGCTTCGAATGCAGTGAGGCCCTGTCTGACGACCTGGAGTGGAAGATCATTTATGTGGGCTCAGCTGAGAGTGAGGAGTTTGATCAGATCCTAGATTCAGTGCTGGTGGGCCCTGTCCCTGCAGGAAGGCATATGTTCGTCTTTCAGGCTGATGCCCCAAACCCATCCCTCATTCCTGAG...ACGGACGCCGTGGGTGTGACTGTGGTTCTCATCACCTGCACCTACCATGGACAAGAGTTCATCCGTGTGGGCTACTATGTCAACAATGAGTACCCAGACCCAGAGCTTCGAGAGAACCCACCCCCA...............AAGCCAGACTTCTCTCAGCTACAGCGGAACATCTTGGCCTCTAACCCCCGGGTGACCCGATTCCATATCAACTGGGACAAC
TRN  10010101100011001
NAM  Q9V464_DROME/1-155
ASQ  MAKVHITNVVVL-DNPSSFFNPFQFELTFECIEELKEDLEWKMIYVGSAESEEHDQVLDTIYVGPVPEGRHIFVFQADPPDVSKIPE.PDAVGVTIVLLTCSYRGQEFVRVGYYVNNDYADPEMRENPPT.....KPLFEKLTRNILASKPRVTRFKINWDY
DSQ  ATGGCCAAGGTGCACATCACCAACGTGGTGGTGCTG---GACAACCCGAGCAGCTTCTTCAACCCCTTTCAGTTCGAACTCACGTTCGAGTGCATTGAGGAGCTAAAAGAGGATCTAGAGTGGAAGATGATCTATGTAGGCTCGGCGGAGTCCGAGGAGCACGACCAGGTGCTGGACACCATATACGTGGGACCTGTGCCTGAGGGGCGACACATCTTTGTCTTCCAGGCGGATCCGCCAGACGTCAGCAAGATCCCGGAA...CCGGATGCGGTGGGCGTTACCATTGTTCTGCTTACCTGCTCCTACCGCGGCCAGGAGTTCGTCCGCGTGGGCTACTATGTGAATAACGACTACGCTGACCCGGAGATGCGCGAGAACCCGCCAACA...............AAGCCTCTTTTCGAGAAGCTGACGCGAAACATCCTGGCCAGCAAGCCGCGCGTCACCCGATTCAAAATCAATTGGGACTAC
TRN  10010101100011011
NAM  Q9C9M6_ARATH/1-155
ASQ  MSAIKITNVAVL-HNPAPFVSPFQFEISYECLNSLKDDLEWKLIYVGSAEDETYDQLLESVLVGPVNVGNYRFVFQADPPDPSKIQE.EDIIGVTVLLLTCSYMGQEFLRVGYYVNNDYEDEQLKEEPPT.....KVLIDKVQRNILSDKPRVTKFPIDFHP
DSQ  ATGAGTGCAATCAAAATCACCAACGTCGCTGTATTG---CATAATCCTGCTCCTTTTGTTAGCCCTTTTCAGTTCGAGATTTCTTACGAGTGTTTGAATTCTCTCAAAGACGATTTGGAATGGAAGCTTATCTATGTAGGCTCAGCAGAAGATGAGACTTATGATCAACTTCTAGAGAGTGTGCTTGTAGGGCCTGTTAATGTTGGCAACTACCGCTTTGTATTTCAGGCTGATCCTCCGGATCCATCAAAGATTCAGGAG...GAAGACATCATCGGTGTTACTGTGCTATTGTTGACATGTTCTTACATGGGTCAAGAGTTCTTGAGAGTTGGATATTACGTGAACAATGATTATGAGGATGAGCAACTCAAGGAAGAGCCTCCAACT...............AAGGTTTTGATTGATAAAGTTCAGAGGAACATACTTTCCGACAAACCTAGAGTTACTAAATTTCCTATAGATTTTCATCCA
TRN  10010101110011001
NAM  Q9BJ46_LEIMA/3-158
ASQ  DPVLQLLEIELLGANPDAYTNQFQWRMRVEATASLPQTVSVSFVWVGSASSSQHDQVLDDFEVGPLEKGITEFTLECDAPQMELVPV.EDVVGVTILLISFQYRGQEFLRVGYYTQVAYFDAQLNRNPPP.....LPQRELLGRFVAMPQPAVTVNPIDWGQ
DSQ  GATCCCGTGCTGCAGCTGCTAGAGATTGAGCTACTCGGTGCAAACCCAGATGCATACACGAACCAGTTCCAGTGGAGAATGCGTGTGGAGGCGACGGCAAGTTTGCCTCAAACTGTGTCCGTCTCCTTCGTGTGGGTCGGAAGCGCTTCGTCGTCGCAGCATGACCAGGTGCTCGATGACTTCGAGGTTGGACCGCTGGAGAAGGGCATCACTGAGTTCACCTTAGAATGTGATGCCCCGCAGATGGAACTGGTACCAGTG...GAGGACGTGGTAGGCGTGACGATTTTGCTCATCTCGTTTCAGTACCGGGGCCAGGAGTTCCTGCGCGTGGGCTATTACACTCAAGTGGCATACTTTGACGCGCAGCTTAACCGGAACCCCCCACCG...............CTGCCGCAGCGGGAGTTGCTGGGTAGATTTGTTGCCATGCCGCAACCAGCTGTCACAGTCAACCCCATTGACTGGGGTCAA
TRN  10010101100011010
NAM  Q9N927_9TRYP/4-159
ASQ  QPIVQLLEIELIGDNPSSYTQPMHWRMRLEALEALDDTISIAFVWVGSAASPNHDQVLDSFDVGPLAQGVTEFTMECDPPQVELVPT.QEVLGVTILVISFQYREQEFLRVGYYTQVAYFDGRMNNCPPP.....VPQVELMGRFIAMPRPTVTVTPIAWNG
DSQ  CAACCAATTGTACAACTTTTGGAGATAGAACTGATAGGGGACAATCCTTCTTCTTACACCCAACCAATGCACTGGCGGATGCGGTTAGAGGCTTTAGAAGCATTAGATGACACCATATCCATTGCTTTCGTGTGGGTCGGTAGTGCTGCATCACCAAACCATGATCAGGTACTCGATTCCTTTGATGTAGGACCTCTTGCGCAGGGGGTGACGGAATTCACAATGGAATGTGACCCACCGCAGGTGGAGTTGGTTCCTACG...CAGGAAGTGTTAGGGGTTACAATTCTCGTAATATCTTTTCAGTACAGGGAGCAGGAGTTTCTGCGCGTCGGATACTACACGCAAGTCGCTTACTTCGATGGACGTATGAACAACTGCCCTCCGCCA...............GTACCTCAGGTGGAGCTGATGGGGCGATTTATTGCAATGCCGCGGCCGACCGTAACGGTGACACCCATCGCATGGAATGGA
TRN  10010101100011000
//